Overview

  • Product name

  • Description

    Rabbit polyclonal to MA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MA2 aa 2-361.
    Sequence:

    ALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQEVLQETLKSLGRYRL LGKIFRKQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTE FLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPELLAHLLGQAMA HAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAE KKRWLAESLRGPALDLMHIVQADNPSISVEECLEAFKQVFGSLESRRTAQ VRYLKTYQEEGEKVSAYVLRLETLLRRAVEKRAIPRRIADQVRLEQVMAG ATLNQMLWCRLRELKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEE RDGYGRWNHE


    Database link: Q9UL42

  • Positive control

    • IHC-P: Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Brain specific. In some patients suffering from cancers, it is also specifically expressed by the testicular tumor cells.
  • Sequence similarities

    Belongs to the PNMA family.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 40 kDa neuronal protein antibody
    • KIAA0883 antibody
    • MA2 antibody
    • MM2 antibody
    • Onconeuronal antigen Ma2 antibody
    • Paraneoplastic antigen Ma2 antibody
    • Paraneoplastic Ma antigen 2 antibody
    • Paraneoplastic neuronal antigen antibody
    • Paraneoplastic neuronal antigen MM2 antibody
    • PNMA2 antibody
    • PNMA2_HUMAN antibody
    • Retrotransposon gag domain containing 2 antibody
    • RGAG2 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for MA2 with ab234740 at 1/100 dilution in immunohistochemical analysis.

References

ab234740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up