Overview

  • Product name

  • Description

    Rabbit polyclonal to MACC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MACC1 aa 9-77.
    Sequence:

    FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGN NASKVANPFWNQLSASNPF


    Database link: Q6ZN28

  • Positive control

    • IHC-P: Human kidney, colon, colorectal cancer and stomach cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a transcription activator for MET and as a key regulator of HGF-MET signaling. Promotes cell motility, proliferation and hepatocyte growth factor (HGF)-dependent scattering in vitro and tumor growth and metastasis in vivo.
  • Tissue specificity

    Preferentially expressed in metastasizing tumors.
  • Sequence similarities

    Contains 1 SH3 domain.
  • Cellular localization

    Cytoplasm. Nucleus. Mainly found in the cytoplasm in non-metastasizing tumors.
  • Information by UniProt
  • Database links

  • Alternative names

    • 7A5 antibody
    • MACC1 antibody
    • MACC1_HUMAN antibody
    • Metastasis associated in colon cancer 1 antibody
    • Metastasis-associated in colon cancer protein 1 antibody
    • OTTHUMP00000201891 antibody
    • Putative binding protein 7a5 antibody
    • SH3 domain-containing protein 7a5 antibody
    • SH3BP4L antibody
    see all

Images

  • Paraffin embedded sections of human colorectal cancer were stained for MACC1 with ab223710 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin embedded sections of human stomach cancer were stained for MACC1 with ab223710 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin embedded sections of human colon were stained for MACC1 with ab223710 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin embedded sections of human kidney were stained for MACC1 with ab223710 at 1/50 dilution in immunohistochemical analysis.

References

ab223710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up