Overview

  • Product name

  • Description

    Rabbit polyclonal to MACF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MACF1 aa 46-141.
    Sequence:

    LDHREPQSESVTLEHVSKSIGIPEVQDFKNLSGDCQDFRFQQHSANPPHE FQPVESEAVATSGNTDVMQESRFSSATWPRATKSLAKGGFSEKQHP


    Database link: O94854

  • Positive control

    • IHC-P: Human liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab244536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Microtubule-actin crosslinking factor 1 (MACF1/ACF7) belongs to spectraplakin family of proteins which also includes mammalian Bpag1/dystonin, Drosophila Short Stop (Shot) and Caenorhabditis elegans Vab-10. These are large actin-microtubule linker molecules that are essential for various biological processes such as neuronal degeneration, wound healing, gastrulation. MACF1, located on mouse chromosome 4D2.2, was found to play an important role during neurogenesis- it was shown that MACF1 regulates the organization of neuronal microtubules which is essential for axon extension. Furthermore, MACF1 is required in controlling focal adhesion assembly and dynamics. MACF1 behaves as an actin-regulated ATPase and it has the ability to target microtubules that track along F-actin to focal adhesions. MACF1 was also implicated in regulating filopodia formation.
  • Cellular localization

    Cytoplasmic, microtubule. Plasma membrane. Golgi apparatus.
  • Database links

  • Alternative names

    • ABP620 antibody
    • Acf7 antibody
    • Aclp7 antibody
    • Actin cross linking family 7 antibody
    • MACF antibody
    • Microtubule actin crosslinking factor 1 antibody
    • mKIAA0465 antibody
    • R74989 antibody
    • rabeculin alpha antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for MACF1 using ab244536 at 1/1000 dilution in immunohistochemical analysis.

References

ab244536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up