Anti-CCL4/MIP-1 beta antibody (ab25129)
Key features and details
- Rabbit polyclonal to CCL4/MIP-1 beta
- Suitable for: WB
- Reacts with: Mouse
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-CCL4/MIP-1 beta antibody
See all CCL4/MIP-1 beta primary antibodies -
Description
Rabbit polyclonal to CCL4/MIP-1 beta -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse -
Immunogen
Synthetic peptide corresponding to Rat CCL4/MIP-1 beta aa 1-69 (N terminal).
Sequence:MKLCVSAFSLLLLVAAFCDSVLSAPIGSDPPTSCCFSYTSRKIHRNFVMD YYETSSLCSQPAVVFLTKK
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.1% Sodium azide
Constituent: 99.9% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab25129 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000. Predicted molecular weight: 10 kDa.
|
Notes |
---|
WB
1/2000. Predicted molecular weight: 10 kDa. |
Target
-
Function
Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsN-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 20303 Mouse
- SwissProt: P14097 Mouse
-
Alternative names
- MIP 1 beta antibody
- Secreted protein G 26 antibody
- ACT 2 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (5)
ab25129 has been referenced in 5 publications.
- Wan J et al. Circular RNA hsa_circ_0002483 promotes growth and invasion of lung adenocarcinoma by sponging miR-125a-3p. Cancer Cell Int 21:533 (2021). PubMed: 34641879
- Guo X et al. Effects of Ginkgo biloba on Early Decompression after Spinal Cord Injury. Evid Based Complement Alternat Med 2020:6958246 (2020). PubMed: 32565871
- Li L et al. High levels of CCL2 or CCL4 in the tumor microenvironment predict unfavorable survival in lung adenocarcinoma. Thorac Cancer 9:775-784 (2018). PubMed: 29722145
- Tomas-Sanchez C et al. Prophylactic Chronic Zinc Administration Increases Neuroinflammation in a Hypoxia-Ischemia Model. J Immunol Res 2016:4039837 (2016). ELISA ; Rat . PubMed: 27635404
- Leng Y et al. Effects of acute intra-abdominal hypertension on multiple intestinal barrier functions in rats. Sci Rep 6:22814 (2016). PubMed: 26980423