Overview

  • Product name

    Anti-Macrophage inflammatory protein 5 antibody
    See all Macrophage inflammatory protein 5 primary antibodies
  • Description

    Rabbit polyclonal to Macrophage inflammatory protein 5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Macrophage inflammatory protein 5 aa 22-113. Expressed in E. coli.
    Sequence:

    QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYF ETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI


    Database link: Q16663

  • Positive control

    • Human pancreas tissue; Recombinant human Macrophage inflammatory protein 5.

Properties

Applications

Our Abpromise guarantee covers the use of ab219388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/400. Predicted molecular weight: 12 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function

    Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15.
  • Tissue specificity

    Most abundant in heart, skeletal muscle and adrenal gland. Lower levels in placenta, liver, pancreas and bone marrow. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are found in high levels in synovial fluids from rheumatoid patients.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C-C motif chemokine 15 antibody
    • C-C motif chemokine ligand 15 antibody
    • CC chemokine 3 antibody
    • CCL15 antibody
    • CCL15(29-92) antibody
    • CCL15_HUMAN antibody
    • Chemokine (C C motif) ligand 15 antibody
    • Chemokine CC-2 antibody
    • Chemokine CC2 antibody
    • HCC-2 antibody
    • HCC2 antibody
    • HMRP 2B antibody
    • HMRP2B antibody
    • Leukotactin 1 antibody
    • Leukotactin-1 antibody
    • LKN-1 antibody
    • LKN1 antibody
    • Macrophage inflammatory protein 5 antibody
    • MIP 1D antibody
    • MIP-1 delta antibody
    • MIP-1D antibody
    • MIP-5 antibody
    • MIP1 delta antibody
    • MIP1d antibody
    • MIP5 antibody
    • MRP 2B antibody
    • Mrp-2b antibody
    • Mrp2b antibody
    • NCC 3 antibody
    • NCC-3 antibody
    • NCC3 antibody
    • New CC chemokine 3 antibody
    • OTTHUMP00000163955 antibody
    • SCYA15 antibody
    • SCYL3 antibody
    • Small inducible cytokine A15 antibody
    • Small inducible cytokine subfamily A (Cys Cys), member 15 antibody
    • Small-inducible cytokine A15 antibody
    • SY15 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human pancreas tissue labeling Macrophage inflammatory protein 5 with ab219388 at 10 µg/mL.

  • Anti-Macrophage inflammatory protein 5 antibody (ab219388) at 1/100 dilution + recombinant human Macrophage inflammatory protein 5

    Predicted band size: 12 kDa

References

ab219388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up