Overview

  • Product name
    Anti-Macrophage Specific Gene antibody
    See all Macrophage Specific Gene primary antibodies
  • Description
    Rabbit polyclonal to Macrophage Specific Gene
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Macrophage Specific Gene aa 52-236. (BC112230).
    Sequence:

    DNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEIL ESWANYQSSTSYSINTELSLFSKVNGKFSTEFQRMKTLQVKDQAITTRVQ VRNLVYTVKINPTLELSSGFRKELLDISDRLENNQTRMATYLAELLVLNY GTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAV


    Database link: Q2M385

  • Positive control
    • HeLa and HepG2 cell lysates; Human kidney tissue.

Properties

  • Form
    Lyophilised:Reconstitute in 200 µl of steriled distilled water.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 79 kDa.
IHC-P 1/100 - 1/500.

Target

Images

  • All lanes : Anti-Macrophage Specific Gene antibody (ab176974) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate

    Predicted band size: 79 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling Macrophage Specific Gene with ab176974 at 1/100 dilution.

References

This product has been referenced in:
  • McCormack RM  et al. Enteric pathogens deploy cell cycle inhibiting factors to block the bactericidal activity of Perforin-2. Elife 4:N/A (2015). WB . Read more (PubMed: 26418746) »
  • McCormack RM  et al. Perforin-2 is essential for intracellular defense of parenchymal cells and phagocytes against pathogenic bacteria. Elife 4:N/A (2015). WB . Read more (PubMed: 26402460) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up