Overview

  • Product name

  • Description

    Rabbit polyclonal to MAD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human MAD1 aa 1-718.
    Sequence:

    MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQ LEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREV DRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKED SLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKK CQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELV RLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETL VGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKD KNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKR VLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSA EMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADT LRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPT SVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKE VAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYR LTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSI PAFLSSLTLELFSRQTVA


    Database link: Q9Y6D9

  • Positive control

    • HepG2 and HeLa cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 83 kDa.

Target

  • Function

    Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. May recruit MAD2L1 to unattached kinetochores. Has a role in the correct positioning of the septum. Required for anchoring MAD2L1 to the nuclear periphery. Binds to the TERT promoter and represses telomerase expression, possibly by interfering with MYC binding.
  • Tissue specificity

    Expressed weakly at G0/G1 and highly at late S and G2/M phase.
  • Involvement in disease

    Defects in MAD1L1 are involved in the development and/or progression of various types of cancer.
  • Sequence similarities

    Belongs to the MAD1 family.
  • Post-translational
    modifications

    Phosphorylated; by BUB1. Become hyperphosphorylated in late S through M phases or after mitotic spindle damage.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > microtubule organizing center > centrosome. Cytoplasm > cytoskeleton > spindle. From the beginning to the end of mitosis, it is seen to move from a diffusely nuclear distribution to the centrosome, to the spindle midzone and finally to the midbody. Colocalizes with NEK2 at the kinetochore.
  • Information by UniProt
  • Database links

  • Alternative names

    • hMAD1 antibody
    • HsMAD1 antibody
    • MAD1 antibody
    • MAD1 mitotic arrest deficient like 1 (yeast) antibody
    • MAD1-like protein 1 antibody
    • MAD1L1 antibody
    • MD1L1_HUMAN antibody
    • Mitotic arrest deficient 1 antibody
    • Mitotic arrest deficient 1-like protein 1 antibody
    • Mitotic checkpoint MAD1 protein homolog antibody
    • Mitotic spindle assembly checkpoint protein MAD1 antibody
    • PIG9 antibody
    • Tax binding protein 181 antibody
    • Tax-binding protein 181 antibody
    • TP53I9 antibody
    • Tumor protein p53 inducible protein 9 antibody
    • TXBP181 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175245. Blue DAPI for nuclear staining.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung cancer tissue labelling MAD1 with ab175245 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human thyroid cancer tissue labelling MAD1 with ab175245 at 1/200. Magnification: 400x.
  • All lanes : Anti-MAD1 antibody (ab175245) at 1/500 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : HeLa cell lysate

    Predicted band size: 83 kDa

References

This product has been referenced in:

  • Raab M  et al. PLK1 has tumor-suppressive potential in APC-truncated colon cancer cells. Nat Commun 9:1106 (2018). Read more (PubMed: 29549256) »
  • Cao L  et al. AR-PDEF pathway promotes tumour proliferation and upregulates MYC-mediated gene transcription by promoting MAD1 degradation in ER-negative breast cancer. Mol Cancer 17:136 (2018). Read more (PubMed: 30217192) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up