Overview

  • Product name

  • Description

    Mouse polyclonal to Mad2L2/REV7
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Full length protein corresponding to Human Mad2L2/REV7 aa 1-211. (AAH15244.1)
    Sequence:

    MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNV PVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVF EITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLV HTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQ LYVEERAHKGS

  • Positive control

    • Mad2L2/REV7 transfected 293T cell lysate.
  • General notes

     This product was previously labelled as Mad2L2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab168660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Function

    Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. May also regulate another aspect of cellular response to DNA damage through regulation of the JNK-mediated phosphorylation and activation of the transcriptional activator ELK1. Inhibits the FZR1- and probably CDC20-mediated activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Regulates TCF7L2-mediated gene transcription and may play a role in epithelial-mesenchymal transdifferentiation.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 1 HORMA domain.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homolog of REV7 S cerevisiae antibody
    • hREV7 antibody
    • MAD2 (mitotic arrest deficient yeast, homolog) like 2 antibody
    • MAD2 homolog antibody
    • MAD2 like 2 antibody
    • MAD2 mitotic arrest deficient like 2 antibody
    • MAD2-like protein 2 antibody
    • MAD2B antibody
    • Mad2l2 antibody
    • MD2L2_HUMAN antibody
    • Mitotic Arrest Deficient 2 L2 antibody
    • Mitotic arrest deficient 2-like protein 2 antibody
    • Mitotic arrest deficient homolog like 2 antibody
    • Mitotic arrest deficient like 2 (yeast) antibody
    • Mitotic arrest deficient yeast homolog antibody
    • Mitotic spindle assembly checkpoint protein MAD2B antibody
    • Polymerase (DNA directed) zeta 2 accessory subunit antibody
    • POLZ2 antibody
    • REV 7 antibody
    • REV7 antibody
    • REV7 homolog antibody
    • Weakly similar to Mitotic MAD2 protein (S cerevisiae) antibody
    see all

Images

  • All lanes : Anti-Mad2L2/REV7 antibody (ab168660) at 1 µg/ml

    Lane 1 : MAD2L2/REV7 transfected 293T lysate.
    Lane 2 : Non-transfected 293T lysate.

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 24 kDa

References

ab168660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up