Overview

  • Product name

  • Description

    Rabbit polyclonal to MAD4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MAD4 aa 25-61.
    Sequence:

    HGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNEL


    Database link: Q14582

  • Positive control

    • WB: RT4 and U251 MG cell lysates. ICC/IF: HEK293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

WB 1/100 - 1/250. Predicted molecular weight: 24 kDa.

Target

  • Function

    Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
  • Sequence similarities

    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHc12 antibody
    • Class C basic helix loop helix protein 12 antibody
    • Class C basic helix-loop-helix protein 12 antibody
    • MAD 4 antibody
    • MAD4 antibody
    • Mad4 homolog antibody
    • MAD4_HUMAN antibody
    • Max associated protein 4 antibody
    • MAX dimerization protein 4 antibody
    • Max dimerizer 4 antibody
    • Max interacting transcriptional repressor MAD4 antibody
    • Max-associated protein 4 antibody
    • Max-interacting transcriptional repressor MAD4 antibody
    • MST 149 antibody
    • MST149 antibody
    • MSTP 149 antibody
    • MSTP149 antibody
    • MXD 4 antibody
    • MXD4 antibody
    see all

Images

  • All lanes : Anti-MAD4 antibody (ab220495) at 1/100 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate

    Predicted band size: 24 kDa

  • Immunofluorescent analysis of HEK293 cells (PFA-fixed/Triton X-100 permeabilized) labeling MAD4 with ab220495 at 4 μg/mL (green).

References

ab220495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (keratinocytes)
Gel Running Conditions
Reduced Denaturing (gel anyKd BioRad)
Loading amount
40 µg
Specification
keratinocytes
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Mr. Julien Coutier

Verified customer

Submitted Sep 04 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up