Overview

  • Product name

  • Description

    Rabbit polyclonal to MAdCAM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human MAdCAM1 aa 95-135 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACT


    Database link: Q13477

  • Positive control

    • Mouse intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
  • Tissue specificity

    Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the thymus, prostate, ovaries, testis, heart, placenta, lung, liver, skeletal muscle, kidney or peripheral blood leukocytes.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Post-translational
    modifications

    The Ser/Thr-rich mucin-like domain may provide possible sites for O-glycosylation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Addressin mucosal antibody
    • hMAdCAM 1 antibody
    • hMAdCAM-1 antibody
    • MACAM1 antibody
    • MADCA_HUMAN antibody
    • MAdCAM 1 antibody
    • MAdCAM-1 antibody
    • Madcam1 antibody
    • Mucosal addressin cell adhesion molecule 1 antibody
    • Mucosal vascular addressin cell adhesion molecule 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded mouse intestine tissue labeling MAdCAM1 with ab214198 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up