For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    madh7smad7-antibody-ab244424.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Signaling Pathway Nuclear Signaling SMADs
Share by email

Anti-MADH7/SMAD7 antibody (ab244424)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
  • Immunocytochemistry/ Immunofluorescence - Anti-MADH7/SMAD7 antibody (ab244424)

Key features and details

  • Rabbit polyclonal to MADH7/SMAD7
  • Suitable for: ICC/IF, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human MADH7/SMAD7 protein (ab114358)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Primary
Product image
Anti-Smad3 antibody [EP568Y] (ab40854)

View more associated products

Overview

  • Product name

    Anti-MADH7/SMAD7 antibody
    See all MADH7/SMAD7 primary antibodies
  • Description

    Rabbit polyclonal to MADH7/SMAD7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MADH7/SMAD7 aa 173-295.
    Sequence:

    EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPT ADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTR VGRLYCVQEPSLDIFYDLPQGNG


    Database link: O15105
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human lung, placenta and colon tissues. ICC/IF: U-251 MG cells.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • Nuclear Signaling
    • SMADs
    • Epigenetics and Nuclear Signaling
    • Nuclear Signaling Pathways
    • SMADs

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Recombinant Protein

    • Recombinant Human MADH7/SMAD7 protein (ab114358)

Applications

Our Abpromise guarantee covers the use of ab244424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.
  • Tissue specificity

    Ubiquitous with higher expression in the lung and vascular endothelium.
  • Involvement in disease

    Colorectal cancer 3
  • Sequence similarities

    Belongs to the dwarfin/SMAD family.
    Contains 1 MH1 (MAD homology 1) domain.
    Contains 1 MH2 (MAD homology 2) domain.
  • Post-translational
    modifications

    Phosphorylation on Ser-249 does not affect its stability, nuclear localization or inhibitory function in TGFB signaling; however it affects its ability to regulate transcription (By similarity). Phosphorylated by PDPK1.
    Ubiquitinated by WWP1 (By similarity). Polyubiquitinated by RNF111, which is enhanced by AXIN1 and promotes proteasomal degradation. In response to TGF-beta, ubiquitinated by SMURF1; which promotes its degradation.
    Acetylation prevents ubiquitination and degradation mediated by SMURF1.
  • Cellular localization

    Nucleus. Cytoplasm. Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236).
  • Target information above from: UniProt accession O15105 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 4092 Human
    • Entrez Gene: 17131 Mouse
    • Entrez Gene: 81516 Rat
    • Omim: 602932 Human
    • SwissProt: O15105 Human
    • SwissProt: O35253 Mouse
    • SwissProt: O88406 Rat
    • Unigene: 465087 Human
    • Unigene: 34407 Mouse
    • Unigene: 29980 Rat
    see all
  • Alternative names

    • CRCS3 antibody
    • FLJ16482 antibody
    • hSMAD 7 antibody
    • hSMAD7 antibody
    • MAD (mothers against decapentaplegic Drosophila) homolog 7 antibody
    • MAD antibody
    • Mad homolog 7 antibody
    • MAD homolog 8 antibody
    • MAD mothers against decapentaplegic homolog 7 antibody
    • MADH 7 antibody
    • MADH 8 antibody
    • MADH6 antibody
    • MADH7 antibody
    • MADH8 antibody
    • Mothers Against Decapentaplegic Drosophila Homolog of 6 antibody
    • Mothers Against Decapentaplegic Drosophila Homolog of 7 antibody
    • Mothers against decapentaplegic homolog 7 antibody
    • Mothers against decapentaplegic homolog 8 antibody
    • Mothers against DPP homolog 7 antibody
    • Mothers against DPP homolog 8 antibody
    • SMA- AND MAD-RELATED PROTEIN 7 antibody
    • SMAD 7 antibody
    • SMAD antibody
    • SMAD family member 7 antibody
    • SMAD, mothers against DPP homolog 7 (Drosophila) antibody
    • SMAD, mothers against DPP homolog 7 antibody
    • SMAD6 antibody
    • Smad7 antibody
    • SMAD7_HUMAN antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
    Paraffin-embedded human lung tissue stained for MADH7/SMAD7 using ab244424 at 1/50 dilution in immunohistochemical analysis.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
    Paraffin-embedded human liver tissue stained for MADH7/SMAD7 using ab244424 at 1/50 dilution in immunohistochemical analysis.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
    Paraffin-embedded human colon tissue stained for MADH7/SMAD7 using ab244424 at 1/50 dilution in immunohistochemical analysis.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MADH7/SMAD7 antibody (ab244424)
    Paraffin-embedded human placenta tissue stained for MADH7/SMAD7 using ab244424 at 1/50 dilution in immunohistochemical analysis.
  • Immunocytochemistry/ Immunofluorescence - Anti-MADH7/SMAD7 antibody (ab244424)
    Immunocytochemistry/ Immunofluorescence - Anti-MADH7/SMAD7 antibody (ab244424)

    PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for MADH7/SMAD7 (green) using ab244424 at 4 µg/ml in ICC/IF.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab244424? Please let us know so that we can cite the reference in this datasheet.

    ab244424 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab244424.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.