Overview

  • Product name

  • Description

    Rabbit polyclonal to MAEA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chicken, Xenopus laevis, Zebrafish, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human MAEA aa 136-379. (Expressed in E.coli).
    Sequence:

    CGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLAWCHDN KSRLRKMKSCLEFSLRIQEFIELIRQNKRLDAVRHARKHFSQAEGSQLDE VRQAMGMLAFPPDTHISPYKDLLDPARWRMLIQQFRYDNYRLHQLGNNSV FTLTLQAGLSAIKTPQCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCAN SRLVCKISGDVMNENNPPMMLPNGYVYGYNSLLSIRQDDKVVCP


    Database link: Q7L5Y9

  • Positive control

    • WB: Recombinant human MAEA protein; Mouse cerebrum and pancreas lysates. IHC-P: Human breast cancer, skin cancer, cerebrum, colorectal cancer, bile duct cancer and kidney tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232987 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 45 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Plays a role in erythroblast enucleation and in the development of the mature macrophages. Mediates the attachment of erythroid cell to mature macrophages, in correlation with the presence of MAEA at cell surface of mature macrophages; This MAEA-mediated contact inhibits erythroid cells apoptosis. Participates to erythroblastic island formation, which is the functional unit of definitive erythropoiesis. Associates with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 CTLH domain.
    Contains 1 LisH domain.
  • Developmental stage

    Localized with condensed chromatin at prophase; Detected in nuclear spindle poles at metaphase and in the contractile ring during telophase and cytokinesis.
  • Cellular localization

    Nucleus matrix. Cell membrane. Cytoplasm, cytoskeleton. Localized as nuclear speckled-like pattern.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110030D19Rik antibody
    • Cell proliferation inducing gene 5 protein antibody
    • Cell proliferation-inducing gene 5 protein antibody
    • EMLP antibody
    • EMP antibody
    • Erythroblast macrophage protein antibody
    • GID complex subunit 9 FYV10 homolog antibody
    • GID9 antibody
    • HLC 10 antibody
    • HLC-10 antibody
    • HLC10 antibody
    • Human lung cancer oncogene 10 protein antibody
    • Lung cancer related protein 10 antibody
    • Macrophage erythroblast attacher antibody
    • MAEA antibody
    • MAEA_HUMAN antibody
    • MGC93683 antibody
    • PIG5 antibody
    • Proliferation inducing gene 5 antibody
    see all

Images

  • Anti-MAEA antibody (ab232987) at 2 µg/ml + Recombinant human MAEA protein

    Predicted band size: 45 kDa

  • Anti-MAEA antibody (ab232987) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 45 kDa

  • Anti-MAEA antibody (ab232987) at 2 µg/ml + Mouse pancreas lysate

    Predicted band size: 45 kDa

  • Paraffin-embedded human breast cancer tissue stained for MAEA using ab232987 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human skin cancer tissue stained for MAEA using ab232987 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for MAEA using ab232987 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human colorectal cancer tissue stained for MAEA using ab232987 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for MAEA using ab232987 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human bile duct cancer tissue stained for MAEA using ab232987 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for MAEA using ab232987 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up