Overview

  • Product name

  • Description

    Rabbit polyclonal to MafB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human MafB aa 18-140.
    Sequence:

    MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSV PSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPV PQPLQSFDSFRGAHHHHHHHHPH


    Database link: Q9Y5Q3

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: SiHa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Acts as a transcriptional activator or repressor. Plays a pivotal role in regulating lineage-specific hematopoiesis by repressing ETS1-mediated transcription of erythroid-specific genes in myeloid cells. Required for monocytic, macrophage, podocyte and islet beta cell differentiation. Involved in renal tubule survival and F4/80 maturation. Activates the insulin and glucagon promoters. Together with PAX6, transactivates weakly the glucagon gene promoter through the G1 element. SUMO modification controls its transcriptional activity and ability to specify macrophage fate. Binds element G1 on the glucagon promoter (By similarity). Involved either as an oncogene or as a tumor suppressor, depending on the cell context.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in MAFB are the cause of multicentric carpotarsal osteolysis syndrome (MCTO) [MIM:166300]. MCTO is a rare skeletal disorder, usually presenting in early childhood with a clinical picture mimicking juvenile rheumatoid arthritis. Progressive destruction of the carpal and tarsal bone usually occurs and other bones may also be involved. Chronic renal failure is a frequent component of the syndrome. Mental retardation and minor facial anomalies have been noted in some patients.
  • Sequence similarities

    Belongs to the bZIP family. Maf subfamily.
    Contains 1 bZIP domain.
  • Domain

    The leucine-zipper domain is involved in the interaction with LRPICD.
  • Post-translational
    modifications

    Phosphorylated by GSK3 and MAPK13 on serine and threonine residues.
    Sumoylated. Sumoylation on Lys-32 and Lys-297 stimulates its transcriptional repression activity and promotes macrophage differentiation from myeloid progenitors.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Kreisler antibody
    • Kreisler (mouse) maf related leucine zipper homolog antibody
    • Kreisler maf related leucine zipper homolog antibody
    • KRML antibody
    • MAF bZIP transcription factor B antibody
    • Maf-B antibody
    • Mafb antibody
    • MAFB/Kreisler basic region/leucine zipper transcription factor antibody
    • MAFB_HUMAN antibody
    • MGC43127 antibody
    • Segmentation protein KR antibody
    • Transcription factor MafB antibody
    • V maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian) antibody
    • V-maf musculoaponeurotic fibrosarcoma oncogene homolog B antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for MafB using ab223744 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized SiHa cells stained for MafB (green) using ab223744 at 4 µg/ml in ICC/IF.

References

ab223744 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223744.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up