Overview

  • Product name

  • Description

    Rabbit polyclonal to MAFK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, ChIP, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MAFK aa 1-156.
    Sequence:

    MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVT RLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSM RLELDALRSKYEALQTFARTVARGPVAPSKVATTSVITIVKSTELSSTSV PFSAAS


    Database link: O60675

  • Positive control

    • WB: Jurkat whole cell lysate. IP: Jurkat whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab229766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/100 - 1/500.
ChIP Use at an assay dependent concentration.
WB 1/500 - 1/3000. Predicted molecular weight: 18 kDa.

Target

  • Function

    Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor.
  • Sequence similarities

    Belongs to the bZIP family. Maf subfamily.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Erythroid transcription factor NF E2 p18 subunit antibody
    • Erythroid transcription factor NF-E2 p18 subunit antibody
    • FLJ32205 antibody
    • MAFK antibody
    • MAFK_HUMAN antibody
    • MGC71717 antibody
    • Nfe2u antibody
    • P18 antibody
    • Transcription factor MafK antibody
    • V maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian) antibody
    see all

Images

  • Anti-MAFK antibody (ab229766) at 1/500 dilution + Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Predicted band size: 18 kDa



    15% SDS-PAGE gel.

  • MAFK was immunoprecipitated from Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate with 4 μg of ab229766. Western blot was performed from the immunoprecipitate using ab229766 at 1/500 dilution.

    Lane 1: Control IgG instead of ab229766 in Jurkat whole cel lysate (input).
    Lane 2: ab229766 IP in Jurkat whole cell lysate.

  • Cross-linked ChIP was performed with HepG2 (human liver hepatocellular carcinoma cell line) chromatin extract treated with LPS (10 ng/ml for 1 h) using 5 μg of either normal rabbit IgG or ab229766.
    The precipitated DNA was detected by PCR with primer set targeting to IL-8 or GAPDH.

References

ab229766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up