Overview

  • Product name

    Anti-MAGEA1 antibody [MA454]
    See all MAGEA1 primary antibodies
  • Description

    Mouse monoclonal [MA454] to MAGEA1
  • Host species

    Mouse
  • Specificity

    ab193330 does not cross-react with MAGE-2, -3, -4, -6 -9, -10, -or -12 proteins.
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, IHC-Fr, IPmore details
  • Species reactivity

    Reacts with: Rat, Dog, Human
  • Immunogen

    Recombinant full length protein corresponding to Human MAGEA1 aa 1-309.
    Sequence:

    MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAG STDPPQSPQG ASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLF RAVITKKVADLVGFLLLKYRAR EPVTKAEMLESVIKNYKHCFPEIFGK ASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYD GLLGDNQIMPKTGF LIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLT QD LVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRF FFPSLREA ALREEEEGV


    Database link: P43355

  • Positive control

    • Human testis tissue, Melanoma cell lines. Melanomas, gliomas, neuroblastoma, non-small cell lung cancer, breast, gastric, colorectal, ovarian, and renal cell carcinomas.
  • General notes

     This product was previously labelled as MAGE 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab193330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 42-46 kDa (predicted molecular weight: 34 kDa).
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use 0.5-1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-Fr Use a concentration of 0.5 - 1 µg/ml.
IP Use 1-2 µg for 500 µg of chromatin.

Target

  • Function

    May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
  • Tissue specificity

    Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. Never expressed in kidney tumors, leukemias and lymphomas.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen MZ2 E antibody
    • Antigen MZ2-E antibody
    • Cancer/testis antigen 1.1 antibody
    • cancer/testis antigen family 1, member 1 antibody
    • CT1.1 antibody
    • MAGA1_HUMAN antibody
    • MAGE 1 antigen antibody
    • MAGE-1 antigen antibody
    • MAGE1 antibody
    • MAGE1A antibody
    • MAGEA1 antibody
    • Melanoma antigen 1 antibody
    • Melanoma antigen family A 1 (directs expression of antigen MZ2 E) antibody
    • Melanoma antigen family A 1 antibody
    • Melanoma antigen MAGE 1 antibody
    • Melanoma associated antigen 1 antibody
    • Melanoma associated antigen MZ2 E antibody
    • Melanoma-associated antigen 1 antibody
    • MGC9326 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed paraffin embedded human testis labeling MAGEA1 with ab193330 at  0.5 μg/ml

References

ab193330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up