Overview

  • Product name

    Anti-MAGEA4 antibody [OTI1F9]
    See all MAGEA4 primary antibodies
  • Description

    Mouse monoclonal [OTI1F9] to MAGEA4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MAGEA4 aa 1-317. Produced in HEK-293T cells (NP_001011550).
    Sequence:

    MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGT LEEVPAAESAGPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSP DAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPV IFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKT GLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQD WVQENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRI AYPSLREAALLEEEEGV


    Database link: P43358

  • Positive control

    • IHC-P: Human bladder carcinoma tissue. WB: HEK-293T cell lysate transfected with pCMV6-ENTRY MAGEA4 cDNA.
  • General notes

    Clone OTI1F9 (formerly 1F9).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI1F9
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab139297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/4000. Predicted molecular weight: 35 kDa.
IHC-P 1/150.

Target

  • Function

    Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
  • Tissue specificity

    Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 1.4 antibody
    • CT1.4 antibody
    • MAGA4_HUMAN antibody
    • MAGE 4 antibody
    • MAGE 4 antigen antibody
    • MAGE 41 antibody
    • MAGE 41 antigen antibody
    • MAGE 4A antibody
    • MAGE 4B antibody
    • MAGE X2 antibody
    • MAGE X2 antigen antibody
    • MAGE-4 antigen antibody
    • MAGE-41 antigen antibody
    • MAGE-X2 antigen antibody
    • MAGE4 antibody
    • MAGE41 antibody
    • MAGE4A antibody
    • MAGE4B antibody
    • MAGEA 4 antibody
    • MAGEA4 antibody
    • Melanoma antigen family A 4 antibody
    • Melanoma associated antigen 4 antibody
    • Melanoma-associated antigen 4 antibody
    • MGC21336 antibody
    see all

Images

  • All lanes : Anti-MAGEA4 antibody [OTI1F9] (ab139297) at 1/4000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY MAGEA4 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 35 kDa

  • Paraffin-embedded human bladder carcinoma tissue stained for MAGEA4 using ab139297 at 1/150 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Matoso A  et al. Spectrum of findings in orchiectomy specimens of persons undergoing gender confirmation surgery. Hum Pathol 76:91-99 (2018). IHC ; Human . Read more (PubMed: 29555572) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up