Overview

  • Product name

    Anti-MAGEA5 antibody
  • Description

    Rabbit polyclonal to MAGEA5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MAGEA5 aa 1-124.
    Sequence:

    MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL GEVPAAGSPGPLKSPQGASAIPTAIDFTLWRQSIKGSSNQEEEGPSTSPD PESVFRAALSKKVADLIHFLLLKY


    Database link: P43359

  • Positive control

    • IHC-P: Human melanoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Not known, though may play a role tumor transformation or progression.
  • Tissue specificity

    Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 1.5 antibody
    • Cancer/testis antigen family 1 member 5 antibody
    • CT1.5 antibody
    • MAGA5_HUMAN antibody
    • MAGE 5 antigen antibody
    • MAGE 5a antigen antibody
    • MAGE 5b antigen antibody
    • MAGE-5 antigen antibody
    • MAGE5 antibody
    • MAGEA4 antibody
    • MAGEA5 antibody
    • Melanoma antigen family A 5 antibody
    • Melanoma associated antigen 5 antibody
    • Melanoma-associated antigen 5 antibody
    • MGC129526 antibody
    see all

Images

  • Paraffin-embedded human melanoma tissue stained for MAGEA5 with ab238824 at 1/100 dilution in immunohistochemical analysis.

References

ab238824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up