Overview

  • Product name

    Anti-MAGEA8 antibody
  • Description

    Rabbit polyclonal to MAGEA8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human MAGEA8 aa 1-318. Full length protein. The identity of the protein fusion partner is GST. BC002455.
    Sequence:

    MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTL EEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPD PAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHF PDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTP KTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLT QEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARV RISYPSLHEEALGEEKGV


    Database link: P43361

  • Positive control

    • A375 cell and Human lung cancer tissue lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab198031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/400 - 1/2000. Predicted molecular weight: 35 kDa.

Target

  • Function

    Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
  • Tissue specificity

    Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testis and placenta.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 1.8 antibody
    • cancer/testis antigen family 1, member 8 antibody
    • CT1.8 antibody
    • MAGA8_HUMAN antibody
    • MAGE 8 antigen antibody
    • MAGE-8 antigen antibody
    • MAGE8 antigen antibody
    • MAGEA8 antibody
    • Melanoma antigen family A 8 antibody
    • Melanoma associated antigen 8 antibody
    • Melanoma-associated antigen 8 antibody
    • MGC2182 antibody
    see all

Images

  • All lanes : Anti-MAGEA8 antibody (ab198031) at 1/400 dilution

    Lane 1 : A375 cell lysate
    Lane 2 : Human lung cancer tissue lysate

    Lysates/proteins at 40 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 35 kDa


    Exposure time: 30 seconds


    10% SDS-PAGE

References

ab198031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up