Overview

  • Product name

    Anti-MAGEB1 antibody
  • Description

    Rabbit polyclonal to MAGEB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAGEB1 aa 25-155.
    Sequence:

    LKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTAAAAV SCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYK MREPIMKADMLKVVDEKYKDHFTEILNGASR


    Database link: P43366

  • Positive control

    • IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Expressed only in testis.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 3.1 antibody
    • CT3.1 antibody
    • DAM10 antibody
    • DSS AHC critical interval MAGE superfamily 10 antibody
    • DSS-AHC critical interval MAGE superfamily 10 antibody
    • MAGB1_HUMAN antibody
    • MAGE B1 antigen antibody
    • MAGE Xp antibody
    • MAGE-B1 antigen antibody
    • MAGE-XP antigen antibody
    • MAGEB1 antibody
    • MAGEL1 antibody
    • MAGEXP antigen antibody
    • melanoma antigen family B, 1 antibody
    • Melanoma associated antigen B1 antibody
    • Melanoma-associated antigen B1 antibody
    • MGC9322 antibody
    see all

Images

  • Paraffin embedded human testis tissue stained for MAGEB1 with ab224317 (1/50 dilution) in immunohistochemical analysis.

References

ab224317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up