Overview

  • Product name

  • Description

    Rabbit polyclonal to MAGEB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAGEB2 aa 158-199.
    Sequence:

    EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP


    Database link: O15479

  • Positive control

    • U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100

 

Target

  • Relevance

    MAGEB2 is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region. It is expressed in testis and placenta, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21.
  • Database links

  • Alternative names

    • Cancer/testis antigen 3.2 antibody
    • Cancer/testis antigen family 3, member 2 antibody
    • CT3.2 antibody
    • DAM6 antibody
    • DSS AHC critical interval MAGE superfamily 6 antibody
    • DSS/AHC critical interval gene, from MAGE superfamily, 6 antibody
    • MAGE B2 antigen antibody
    • MAGE XP 2 antibody
    • MAGE XP 2 antigen antibody
    • Mage-b2 antibody
    • Mage-rs2 antibody
    • melanoma antigen family B, 2 antibody
    • Melanoma antigen, family B, 1 antibody
    • Melanoma associated antigen B2 antibody
    • MGC2643 antibody
    • MGC26438 antibody
    • Smage-2 protein antibody
    • Smage2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling MAGEB2 with ab221559 at 4 µg/mL (green).

References

ab221559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up