Overview

  • Product name

    Anti-MAGEB6 antibody
  • Description

    Rabbit polyclonal to MAGEB6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAGEB6 aa 101-198.
    Sequence:

    SVPQESQGASPTGSPDAGVSGSKYDVAANGQDEKSPSTSHDVSVPQESQG ASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKK


    Database link: Q8N7X4

  • Positive control

    • IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Expressed in testis. Not expressed in other normal tissues, but is expressed in tumors of different histological origins.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 3.4 antibody
    • Cancer/testis antigen family 3 member 4 antibody
    • CT3.4 antibody
    • MAGB6_HUMAN antibody
    • MAGE B6 antibody
    • MAGE-B6 antigen antibody
    • MAGEB6 antibody
    • MAGEB6 antigen antibody
    • MAGEB6A antibody
    • Melanoma antigen family B 6 antibody
    • Melanoma associated antigen B6 antibody
    • Melanoma-associated antigen B6 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for MAGEB6 using ab224562 at 1/1000 dilution in immunohistochemical analysis.

References

ab224562 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up