Overview

  • Product name
  • Description
    Mouse monoclonal to MAG/GMA
  • Host species
    Mouse
  • Tested applications
    Suitable for: ICC/IF, Flow Cyt, IHC-FoFr, IHC-P, WB, ELISAmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Sheep, Cow, Cat, Human, Monkey
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MAG/GMA aa 119-208.
    Sequence:

    GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPEL RPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR


    Database link: NP_002352

  • Positive control
    • Partial tagged recombinant Human MAG/GMA protein (Immunogen), Jurkat whole cell lysate (ab7899). This antibody gave a positive result in IF in the following Formaldehyde fixed cell line: SKNSH.
  • General notes

     This product was previously labelled as MAG

    This product was changed from ascites to tissue culture supernatant on 4th April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

     

     This product was previously labelled as MAG

     

Properties

Applications

Our Abpromise guarantee covers the use of ab89780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-FoFr Use at an assay dependent concentration.
IHC-P Use at an assay dependent concentration. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use at an assay dependent concentration. Predicted molecular weight: 63 kDa.

Isoform a, 69 kDa; Isoform b, 63 kDa.

ELISA Use at an assay dependent concentration.

Target

  • Function
    Adhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells. Preferentially binds to alpha-2,3-linked sialic acid.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • GMA antibody
    • MAG antibody
    • MAG_HUMAN antibody
    • Myelin associated glycoprotein antibody
    • Myelin-associated glycoprotein antibody
    • S MAG antibody
    • S-MAG antibody
    • Sialic acid binding Ig like lectin 4A antibody
    • Sialic acid binding immunoglobulin like lectin 4A antibody
    • Siglec 4a antibody
    • Siglec-4a antibody
    • SIGLEC4A antibody
    • SPG75 antibody
    see all

Images

  • Anti-MAG/GMA antibody (ab89780) at 5 µg/ml + Jurkat cell lysate at 50 µg

    Predicted band size: 63 kDa
    Observed band size: 53 kDa
    why is the actual band size different from the predicted?



    This image was generated using the ascites version of the product.

  • ab89780 staining MAG/GMA in lamb spinal cord tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde and blocked with 1% BSA for 10 minutes at 21°C; antigen retrieval was by heat mediation in a citrate buffer. Samples were incubated with primary antibody (1/5000 in blocking buffer) for 2 hours at 21°C. A Biotin-conjugated Goat anti-mouse IgG polyclonal (1/200) was used as the secondary antibody.

    This image was generated using the ascites version of the product.

    See Abreview

  • Overlay histogram showing SH-SY5Y cells stained with ab89780 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab89780, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol (5 min) used under the same conditions.
    Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.

    This image was generated using the ascites version of the product.

  • ab89780 stained SKNSH cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab89780 at 10µg/ml overnight at +4°C. The secondary antibody (green) was DyLight® 488 goat anti- mouse (ab96879) IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • ab89780 staining MAG/GMA in Mouse brain tissue sections by Immunohistochemistry (PFA perfusion fixed frozen sections). Tissue samples were fixed by perfusion with acetone, permeablized with methanol and blocked with 5% BSA for 1 hour at 37°C. The sample was incubated with primary antibody (1/100) at 4°C for 18 hours. An Alexa Fluor® 594-conjugated Goat anti-mouse polyclonal (1/200) was used as the secondary antibody.

    This image was generated using the ascites version of the product.

    See Abreview

  • IHC-P image of MAG/GMA staining on cow peripheral nerve sections using ab89780 (1:4000). The sections were fixed in Formaldehyde and subjected to heat mediated antigen retrieval using citric acid (pH 6). The sections were blocked using 1% BSA for 10 mins at 21°C.

    This image was generated using the ascites version of the product.

    See Abreview

  • Anti-MAG/GMA antibody (ab89780) at 5 µg/ml + Partial tagged recombinant Human MAG/GMA protein at 0.2 µg

    Predicted band size: 63 kDa
    Observed band size: 36 kDa why is the actual band size different from the predicted?



    Western blot against tagged recombinant protein immunogen. Predicted band size of immunogen is 36 kDa.

    This image was generated using the ascites version of the product.

References

This product has been referenced in:
  • Chrzanowski U  et al. Evaluation strategy to determine reliable demyelination in the cuprizone model. Metab Brain Dis 34:681-685 (2019). Read more (PubMed: 30607821) »
  • Hainsworth AH  et al. Super-resolution imaging of subcortical white matter using stochastic optical reconstruction microscopy (STORM) and super-resolution optical fluctuation imaging (SOFI). Neuropathol Appl Neurobiol 44:417-426 (2018). Read more (PubMed: 28696566) »
See all 25 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-10 of 19 Abreviews

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (brain tissue)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate ph 6
Permeabilization
No
Specification
brain tissue
Blocking step
Normal Goat Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 26°C
Fixative
Formaldehyde

Herr Dr. Markus Kipp

Verified customer

Submitted Sep 07 2018

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Rat Tissue lysate - whole (Sciatic nerve)
Gel Running Conditions
Reduced Denaturing (8%)
Loading amount
20 µg
Specification
Sciatic nerve
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Feb 19 2016

Application
Western blot
Sample
Mouse Tissue lysate - whole (Sciatic nerve)
Gel Running Conditions
Reduced Denaturing (8%)
Loading amount
20 µg
Specification
Sciatic nerve
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Feb 19 2016

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Sheep Tissue sections (Lamb spinal cord)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citric acid
Permeabilization
No
Specification
Lamb spinal cord
Blocking step
BSA as blocking agent for 10 minute(s) · Concentration: 1% · Temperature: 21°C
Fixative
Formaldehyde

Mr. Carl Hobbs

Verified customer

Submitted Nov 03 2014

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Mouse Tissue sections (brain)
Permeabilization
Yes - methanol
Specification
brain
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 37°C
Fixative
Acetone

Abcam user community

Verified customer

Submitted Sep 16 2013

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Rat Tissue sections (Brain sections)
Antigen retrieval step
None
Permeabilization
No
Specification
Brain sections
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 37°C
Fixative
Acetone

Abcam user community

Verified customer

Submitted Sep 13 2013

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Rat Tissue lysate - whole (cerebral cortex)
Gel Running Conditions
Reduced Denaturing (10% Gel)
Loading amount
100 µg
Specification
cerebral cortex
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 37°C

Abcam user community

Verified customer

Submitted Sep 11 2013

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Lizard Tissue sections (Spinal cord)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citric acid
Permeabilization
No
Specification
Spinal cord
Blocking step
BSA as blocking agent for 10 minute(s) · Concentration: 1% · Temperature: 21°C
Fixative
Formaldehyde

Mr. Carl Hobbs

Verified customer

Submitted Jun 18 2013

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Mouse Tissue lysate - whole (Sciatic nerve)
Gel Running Conditions
Reduced Denaturing (10% gel)
Loading amount
30 µg
Specification
Sciatic nerve
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C

Dr. G.K Sakellariou

Verified customer

Submitted May 15 2013

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (brain)
Specification
brain
Blocking step
Serum as blocking agent for 20 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Formaldehyde

Dr. Rachel Barker

Verified customer

Submitted Nov 06 2012

1-10 of 19 Abreviews

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up