Overview

  • Product name

  • Description

    Rabbit polyclonal to MAGI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MAGI1 aa 686-782.
    Sequence:

    IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQP LERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD


    Database link: Q96QZ7

  • Positive control

    • ICC/IF: U-2 OS (human bone osteosarcoma epithelial cell line) cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May play a role as scaffolding protein at cell-cell junctions. May regulate acid-induced ASIC3 currents by modulating its expression at the cell surface.
  • Tissue specificity

    Widely expressed with the exception of skeletal muscle. Isoform 1, isoform 2 and isoform 6 are highly expressed in colon, kidney, lung, liver, and pancreas. Isoform 5 is predominantly expressed in brain and heart. Isoform 3 and isoform 4 are highly expressed in pancreas and brain.
  • Sequence similarities

    Contains 1 guanylate kinase-like domain.
    Contains 6 PDZ (DHR) domains.
    Contains 2 WW domains.
  • Cellular localization

    Cell junction, tight junction. Cell membrane. Localizes to epithelial cells tight junctions.
  • Information by UniProt
  • Database links

  • Alternative names

    • AIP 3 antibody
    • AIP-3 antibody
    • AIP3 antibody
    • Atrophin 1 interacting protein 3 antibody
    • Atrophin-1-interacting protein 3 antibody
    • BAI1 associated protein 1 antibody
    • BAI1-associated protein 1 antibody
    • BAIAP 1 antibody
    • BAIAP1 antibody
    • BAP 1 antibody
    • BAP-1 antibody
    • BAP1 antibody
    • Gukmi1 antibody
    • MAGI 1 antibody
    • MAGI-1 antibody
    • MAGI1 antibody
    • MAGI1_HUMAN antibody
    • MAGI1c antibody
    • Membrane associated guanylate kinase inverted 1 antibody
    • membrane associated guanylate kinase WW and PDZ domain containing 1 antibody
    • Membrane-associated guanylate kinase antibody
    • Membrane-associated guanylate kinase inverted 1 antibody
    • TNRC 19 antibody
    • TNRC19 antibody
    • Trinucleotide repeat containing gene 19 antibody
    • Trinucleotide repeat containing gene 19 protein antibody
    • Trinucleotide repeat-containing gene 19 protein antibody
    • WW and PDZ domain-containing protein 1 antibody
    • WW domain containing protein 3 antibody
    • WW domain-containing protein 3 antibody
    • WWP 3 antibody
    • WWP3 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MAGI1 (green) using ab222082 at 4 µg/ml in ICC/IF.

References

ab222082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up