Overview

  • Product name

  • Description

    Rabbit polyclonal to MAGP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human MAGP1 aa 6-162. (Expressed in E.coli)
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFLFLLFLPAGLLAQG QYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQ VQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLN EVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGV


    Database link: P55001

  • Positive control

    • IHC-P: Human breast cancer, brain, prostate, prostate cancer and colorectal cancer tissues. WB: Recombinant human MAGP1 protein; Pig liver lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 21 kDa.

Target

  • Function

    Component of the elastin-associated microfibrils.
  • Sequence similarities

    Belongs to the MFAP family.
    Contains 1 SXC (ShKT) domain.
  • Post-translational
    modifications

    Forms intermolecular disulfide bonds either with other MAGP-1 molecules or with other components of the microfibrils. May form transglutaminase cross-links.
    O-glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • MAGP antibody
    • MAGP-1 antibody
    • MAGP1 antibody
    • MFAP-2 antibody
    • Mfap2 antibody
    • MFAP2_HUMAN antibody
    • Microfibril associated glycoprotein antibody
    • Microfibril-associated glycoprotein 1 antibody
    • Microfibrillar associated protein 2 antibody
    • Microfibrillar-associated protein 2 antibody
    see all

Images

  • Anti-MAGP1 antibody (ab231344) at 2 µg/ml + Pig liver tissue lysate.

    Developed using the ECL technique.

    Predicted band size: 21 kDa

  • Anti-MAGP1 antibody (ab231344) at 2 mg/ml + Recombinant human MAGP1 protein.

    Developed using the ECL technique.

    Predicted band size: 21 kDa

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for MAGP1 using ab231344 at 20 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for MAGP1 using ab231344 at 20 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for MAGP1 using ab231344 at 20 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human brain tissue stained for MAGP1 using ab231344 at 20 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for MAGP1 using ab231344 at 20 µg/ml in immunohistochemical analysis.

References

ab231344 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up