Overview

  • Product name

  • Description

    Rabbit polyclonal to MAGP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse MAGP2 aa 25-152. (Expressed in E.coli).
    Sequence:

    GVSGQRGDDVPETFTDDPNLVNDPSTDDTALADITPSTDDLAGDKNATAE CRDEKFACTRLYSVHRPVRQCVHQSCFTSLRRMYIINNEICSRLVCKEHE AMKDELCRQMAGLPPRRLRRSNYFRLPPGVSGQRGDDVPETFTDDPNLVN DPSTDDTALADITPSTDDLAGDKNATAECRDEKFACTRLYSVHRPVRQCV HQSCFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSN YFRLPP


    Database link: Q9QZJ6

  • Positive control

    • WB: Mouse heart and gallbladder lysates; Recombinant mouse MAGP2 protein. IHC-P: Mouse heart tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Component of the elastin-associated microfibrils.
  • Sequence similarities

    Belongs to the MFAP family.
  • Post-translational
    modifications

    Forms intermolecular disulfide bonds either with other MAGP-2 molecules or with other components of the microfibrils.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • AAT9 antibody
    • MAGP 2 antibody
    • MAGP-2 antibody
    • MAGP2 antibody
    • MFAP 5 antibody
    • MFAP-5 antibody
    • MFAP5 antibody
    • MFAP5_HUMAN antibody
    • Microfibril associated glycoprotein 2 antibody
    • Microfibril-associated glycoprotein 2 antibody
    • microfibrillar associated protein 5 antibody
    • Microfibrillar associated protein 5 precursor antibody
    • Microfibrillar-associated protein 5 antibody
    • MP25 antibody
    see all

Images

  • Anti-MAGP2 antibody (ab232846) at 1 µg/ml + Recombinant mouse MAGP2 protein
  • Anti-MAGP2 antibody (ab232846) at 1 µg/ml + Mouse gallbladder lysate
  • Anti-MAGP2 antibody (ab232846) at 1 µg/ml + Mouse heart lysate
  • Formalin-fixed, paraffin-embedded mouse heart tissue stained for MAGP2 using ab232846 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab232846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up