Anti-MAGP2 antibody (ab232873)
Key features and details
- Rabbit polyclonal to MAGP2
- Suitable for: WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-MAGP2 antibody
See all MAGP2 primary antibodies -
Description
Rabbit polyclonal to MAGP2 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human MAGP2 aa 24-162. (Expressed in E.coli).
Sequence:LGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLA SLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEI CSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPC
Database link: Q13361 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab232873 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab232873 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa. |
Target
-
Function
Component of the elastin-associated microfibrils. -
Sequence similarities
Belongs to the MFAP family. -
Post-translational
modificationsForms intermolecular disulfide bonds either with other MAGP-2 molecules or with other components of the microfibrils. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 8076 Human
- Entrez Gene: 362429 Rat
- Omim: 601103 Human
- SwissProt: Q13361 Human
- Unigene: 512842 Human
- Unigene: 25217 Rat
-
Alternative names
- AAT9 antibody
- MAGP 2 antibody
- MAGP-2 antibody
see all
Images
-
Anti-MAGP2 antibody (ab232873) at 2 µg/ml + Recombinant human MAGP2 protein
Predicted band size: 20 kDa -
Anti-MAGP2 antibody (ab232873) at 3 µg/ml + Human serum
Predicted band size: 20 kDa -
Anti-MAGP2 antibody (ab232873) at 3 µg/ml + Rat uterus tissue
Predicted band size: 20 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232873 has not yet been referenced specifically in any publications.