Anti-Major Allergen Bla g 1.0101 antibody (ab234655)

Overview

  • Product name

    Anti-Major Allergen Bla g 1.0101 antibody
  • Description

    Rabbit polyclonal to Major Allergen Bla g 1.0101
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: German cockroach
  • Immunogen

    Recombinant full length protein corresponding to German cockroach Major Allergen Bla g 1.0101 aa 1-412.
    Sequence:

    NLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVD QIIAIATDYLANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEA NGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPIE DLKALFNEKLETSPDFLALYNAIRSPEFQSIVQTLNAMPEYQNLLQKLRE KGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIPVDQIIAIATD YLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDF LNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNE KLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKI IELIRALFGLTH


    Database link: Q9UAM5

  • Positive control

    • WB: Recombinant German cockroach Major Allergen Bla g 1.0101 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab234655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

Images

  • All lanes : Anti-Major Allergen Bla g 1.0101 antibody (ab234655) at 1/500 dilution

    Lane 1 : Recombinant German cockroach Major Allergen Bla g 1.0101 protein, 60 ng
    Lane 2 : Recombinant German cockroach Major Allergen Bla g 1.0101 protein, 30 ng
    Lane 3 : Recombinant German cockroach Major Allergen Bla g 1.0101 protein, 15 ng
    Lane 4 : Recombinant German cockroach Major Allergen Bla g 1.0101 protein, 7.5 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Observed band size: 62 kDa
    why is the actual band size different from the predicted?

References

ab234655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up