Overview

  • Product name

    Anti-Major Basic Protein antibody
    See all Major Basic Protein primary antibodies
  • Description

    Rabbit polyclonal to Major Basic Protein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Major Basic Protein aa 106-222.
    Sequence:

    TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQG QVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGG HWRRAHCLRRLPFICSY


    Database link: P13727

  • Positive control

    • WB: Human placenta lysate. IHC-P: Human liver cancer tissue. ICC/IF: U0251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 25 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
  • Tissue specificity

    High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Developmental stage

    Levels of the proform increase in serum and placenta during pregnancy.
  • Post-translational
    modifications

    Nitrated.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle. The proform is secreted. The mature protein is found in the matrix of the eosinophil's large specific granule and Secreted. The proform is secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BMPG antibody
    • Bone marrow proteoglycan antibody
    • EMBP antibody
    • Eosinophil granule major basic protein antibody
    • Eosinophil major basic protein antibody
    • MBP antibody
    • MBP1 antibody
    • MGC14537 antibody
    • Natural killer cell activator antibody
    • Pregnancy associated major basic protein antibody
    • Pregnancy-associated major basic protein antibody
    • PRG 2 antibody
    • PRG2 antibody
    • PRG2_HUMAN antibody
    • Proteoglycan 2 antibody
    • Proteoglycan 2 bone marrow antibody
    • Proteoglycan 2 preproprotein antibody
    • Proteoglycan2 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for Major Basic Protein using ab236851 at 1/100 dilution in immunohistochemical analysis.

  • Anti-Major Basic Protein antibody (ab236851) at 1/1000 dilution + Human placenta lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 25 kDa

  • U-251 MG (human brain glioma cell line) cells stained for Major Basic Protein (green) using ab236851 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up