Anti-Major pollen allergen Bet v 1-A protein antibody (ab225687)

Overview

  • Product name

    Anti-Major pollen allergen Bet v 1-A protein antibody
  • Description

    Rabbit polyclonal to Major pollen allergen Bet v 1-A protein
  • Host species

    Rabbit
  • Specificity

    Predicted to react with Betula pendula (100% sequence identity).
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein corresponding to Major pollen allergen Bet v 1-A protein aa 2-160. Betula pendula.
    Sequence:

    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP GTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISN EIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESY LLAHSDAYN


    Database link: P15494

  • Positive control

    • WB: Recombinant Betula pendula Major pollen allergen Bet v 1-A protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 34 kDa (predicted molecular weight: 34 kDa).

This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

Images

  • All lanes : Anti-Major pollen allergen Bet v 1-A protein antibody (ab225687) at 1/500 dilution

    Lane 1 : Recombinant Betula pendula Major pollen allergen Bet v 1-A protein, 100 ng
    Lane 2 : Recombinant Betula pendula Major pollen allergen Bet v 1-A protein, 50 ng
    Lane 3 : Recombinant Betula pendula Major pollen allergen Bet v 1-A protein, 25 ng
    Lane 4 : Recombinant Betula pendula Major pollen allergen Bet v 1-A protein, 12.5 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 34 kDa
    Observed band size: 34 kDa



    This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

References

ab225687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up