Overview

  • Product name

  • Description

    Rabbit polyclonal to MALT1/MLT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MALT1/MLT aa 80-215.
    Sequence:

    KVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKI TVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNA VHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESF


    Database link: Q9UDY8

  • Positive control

    • ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as MALT1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Enhances BCL10-induced activation of NF-kappa-B. Involved in nuclear export of BCL10. Binds to TRAF6, inducing TRAF6 oligomerization and activation of its ligase activity. Has ubiquitin ligase activity. MALT1-dependent BCL10 cleavage plays an important role in T-cell antigen receptor-induced integrin adhesion.
  • Tissue specificity

    Highly expressed in peripheral blood mononuclear cells. Detected at lower levels in bone marrow, thymus and lymph node, and at very low levels in colon and lung.
  • Involvement in disease

    Note=A chromosomal aberration involving MALT1 is recurrent in low-grade mucosa-associated lymphoid tissue (MALT lymphoma). Translocation t(11;18)(q21;q21) with BIRC2. This translocation is found in approximately 50% of cytogenetically abnormal low-grade MALT lymphoma.
  • Sequence similarities

    Belongs to the peptidase C14B family.
    Contains 1 death domain.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cytoplasm > perinuclear region. Nucleus. Shuttles between the nucleus and cytoplasm. Found in perinuclear structures together with BCL10.
  • Information by UniProt
  • Database links

  • Alternative names

    • Caspase like protein antibody
    • DKFZp434L132 antibody
    • IMD12 antibody
    • MALT 1 antibody
    • MALT associated translocation antibody
    • MALT lymphoma associated translocation antibody
    • MALT lymphoma-associated translocation antibody
    • Malt1 antibody
    • MALT1 paracaspase antibody
    • MALT1_HUMAN antibody
    • MLT 1 antibody
    • MLT antibody
    • MLT1 antibody
    • Mucosa associated lymphoid tissue lymphoma translocation gene 1 antibody
    • Mucosa associated lymphoid tissue lymphoma translocation protein 1 antibody
    • Mucosa-associated lymphoid tissue lymphoma translocation protein 1 antibody
    • Paracaspase antibody
    • Paracaspase-1 antibody
    • PCASP1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for MALT1/MLT (green) using ab222212 at 4 µg/ml in ICC/IF.

References

ab222212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up