Overview

  • Product name

    Anti-MAMDC4 antibody
  • Description

    Rabbit polyclonal to MAMDC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAMDC4 aa 35-109.
    Sequence:

    VCNFVCDCRDCSDEAQCGYHGASPTLGAPFACDFEQDPCGWRDISTSGYS WLRDRAGAALEGPGPHSDHTLGTDL


    Database link: Q6UXC1

  • Positive control

    • Human spleen tissue; MCF7 cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab221065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Probably involved in the sorting and selective transport of receptors and ligands across polarized epithelia.
  • Sequence similarities

    Contains 3 LDL-receptor class A domains.
    Contains 6 MAM domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AEGP_HUMAN antibody
    • Apical endosomal glycoprotein antibody
    • MAM domain-containing protein 4 antibody
    • MAMDC4 antibody

Images

  • Immunohistochemical analysis of paraffin embedded Human spleen tissue labeling MAMDC4 with ab221065 at 1/1000 dilution. 

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling MAMDC4 with ab221065 at 4 µg/mL (green).

References

ab221065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up