Overview

  • Product name

    Anti-Mannan Binding Lectin/MBL antibody [3B6] (Biotin)
    See all Mannan Binding Lectin/MBL primary antibodies
  • Description

    Mouse monoclonal [3B6] to Mannan Binding Lectin/MBL (Biotin)
  • Host species

    Mouse
  • Conjugation

    Biotin
  • Specificity

    ab191898 is specific for Mannan Binding Lectin/MBL from Human serum or plasma.

  • Tested applications

    Suitable for: Sandwich ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Full length native protein (purified) corresponding to Human Mannan Binding Lectin/MBL aa 21-248. Mannan Binding Lectin purified from Human donor plasma.
    Sequence:

    ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAE NGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDE DCVLLLKNGQWNDVPCSTSHLAVCEFPI


    Database link: P11226

  • Epitope

    The epitope is on the head-neck region of the MBL protein chain.
  • General notes

     This product was previously labelled as Mannan Binding Lectin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    pH: 7.40
    Preservative: 0.09% Sodium azide
    Constituents: 99% PBS, 0.81% Sodium chloride
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Biotinylated.
  • Clonality

    Monoclonal
  • Clone number

    3B6
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use at an assay dependent concentration.

ab23457 may be used as the capture and ab191898 as the detection antibody.

Target

  • Function

    Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
  • Tissue specificity

    Plasma protein produced mainly in the liver.
  • Involvement in disease

    Note=There is an association between low levels of MBL2 and a defect of opsonization which results in susceptibility to frequent and chronic infections.
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 1 collagen-like domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

    see all
  • Alternative names

    • COLEC 1 antibody
    • COLEC1 antibody
    • Collectin-1 antibody
    • HSMBPC antibody
    • Lectin, mannose-binding, soluble, 2 antibody
    • Mannan binding lectin antibody
    • Mannan binding protein antibody
    • Mannan-binding protein antibody
    • Mannose binding lectin (protein C) 2 soluble antibody
    • Mannose binding lectin (protein C) 2, soluble (opsonic defect) antibody
    • Mannose binding lectin (protein C) 2, soluble antibody
    • Mannose binding lectin 2 soluble antibody
    • Mannose binding lectin 2, soluble (opsonic defect) antibody
    • Mannose binding lectin antibody
    • Mannose binding lectin protein C2 soluble opsonic defect antibody
    • Mannose binding protein antibody
    • Mannose binding protein C antibody
    • Mannose binding protein C precursor antibody
    • Mannose binding protein, serum antibody
    • Mannose-binding lectin antibody
    • Mannose-binding protein C antibody
    • MBL 2 antibody
    • MBL antibody
    • MBL2 antibody
    • MBL2_HUMAN antibody
    • MBL2D antibody
    • MBP 1 antibody
    • MBP antibody
    • MBP C antibody
    • MBP-C antibody
    • MBP1 antibody
    • MBPB antibody
    • MBPC antibody
    • MBPD antibody
    • MGC116832 antibody
    • MGC116833 antibody
    • Opsonic defect antibody
    • protein C antibody
    • Soluble mannose binding lectin antibody
    see all

Images

  • Calibration curve for Mannan Binding Lectin/MBL using ab23457 as the capture antibody and ab191898 as the detection antibody.

References

ab191898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up