Overview

  • Product name

    Anti-Mannan Binding Lectin/MBL antibody
    See all Mannan Binding Lectin/MBL primary antibodies
  • Description

    Rabbit polyclonal to Mannan Binding Lectin/MBL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Gorilla
  • Immunogen

    Recombinant full length protein corresponding to Human Mannan Binding Lectin/MBL aa 21-248. Mature protein.
    Sequence:

    ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAE NGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDE DCVLLLKNGQWNDVPCSTSHLAVCEFPI


    Database link: P11226

  • Positive control

    • HepG2, Mouse liver and mouse pancreas extracts.
  • General notes

     This product was previously labelled as Mannan Binding Lectin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 26 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
  • Tissue specificity

    Plasma protein produced mainly in the liver.
  • Involvement in disease

    Note=There is an association between low levels of MBL2 and a defect of opsonization which results in susceptibility to frequent and chronic infections.
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 1 collagen-like domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

    see all
  • Alternative names

    • COLEC 1 antibody
    • COLEC1 antibody
    • Collectin-1 antibody
    • HSMBPC antibody
    • Lectin, mannose-binding, soluble, 2 antibody
    • Mannan binding lectin antibody
    • Mannan binding protein antibody
    • Mannan-binding protein antibody
    • Mannose binding lectin (protein C) 2 soluble antibody
    • Mannose binding lectin (protein C) 2, soluble (opsonic defect) antibody
    • Mannose binding lectin (protein C) 2, soluble antibody
    • Mannose binding lectin 2 soluble antibody
    • Mannose binding lectin 2, soluble (opsonic defect) antibody
    • Mannose binding lectin antibody
    • Mannose binding lectin protein C2 soluble opsonic defect antibody
    • Mannose binding protein antibody
    • Mannose binding protein C antibody
    • Mannose binding protein C precursor antibody
    • Mannose binding protein, serum antibody
    • Mannose-binding lectin antibody
    • Mannose-binding protein C antibody
    • MBL 2 antibody
    • MBL antibody
    • MBL2 antibody
    • MBL2_HUMAN antibody
    • MBL2D antibody
    • MBP 1 antibody
    • MBP antibody
    • MBP C antibody
    • MBP-C antibody
    • MBP1 antibody
    • MBPB antibody
    • MBPC antibody
    • MBPD antibody
    • MGC116832 antibody
    • MGC116833 antibody
    • Opsonic defect antibody
    • protein C antibody
    • Soluble mannose binding lectin antibody
    see all

Images

  • All lanes : Anti-Mannan Binding Lectin/MBL antibody (ab189856) at 1/500 dilution

    Lane 1 : HepG2 cell extract
    Lane 2 : Mouse liver extract
    Lane 3 : Mouse pancreas extract

    Predicted band size: 26 kDa

References

ab189856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up