Overview

  • Product name

    Anti-Mannose Phosphate Isomerase antibody
    See all Mannose Phosphate Isomerase primary antibodies
  • Description

    Rabbit polyclonal to Mannose Phosphate Isomerase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Chimpanzee, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human Mannose Phosphate Isomerase aa 2-423. Expressed in E. coli. N-terminal tags.
    Sequence:

    AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWM GTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVL SVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGF RPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHL MKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGC FAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPK FIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTE VPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGAN ESVSLKLTEPKDLLIFRACCLL


    Database link: P34949

  • Positive control

    • WB: Recombinant human Mannose Phosphate Isomerase protein; HEK-293T whole cell lysate; human lung and pig brain tissue lysate. IHC-P: Human brain, stomach and glioma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 47 kDa.

Target

  • Function

    Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
  • Tissue specificity

    Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.
  • Pathway

    Nucleotide-sugar biosynthesis; GDP-alpha-D-mannose biosynthesis; alpha-D-mannose 1-phosphate from D-fructose 6-phosphate: step 1/2.
  • Involvement in disease

    Defects in MPI are the cause of congenital disorder of glycosylation type 1B (CDG1B) [MIM:602579]; also known as carbohydrate-deficient glycoprotein syndrome type Ib (CDGS1B). Congenital disorders of glycosylation are metabolic deficiencies in glycoprotein biosynthesis that usually cause severe mental and psychomotor retardation. They are characterized by under-glycosylated serum glycoproteins. CDG1B is clinically characterized by protein-losing enteropathy.
  • Sequence similarities

    Belongs to the mannose-6-phosphate isomerase type 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • PMI1 antibody
    • CDG1B antibody
    • FLJ39201 antibody
    • Mannose 6 phosphate isomerase antibody
    • Mannose-6-phosphate isomerase antibody
    • MANNOSEPHOSPHATE ISOMERASE antibody
    • MGC94106 antibody
    • MPI antibody
    • MPI_HUMAN antibody
    • Phosphohexomutase antibody
    • phosphomannose isomerase 1 antibody
    • Phosphomannose isomerase antibody
    • PMI antibody
    see all

Images

  • All lanes : Anti-Mannose Phosphate Isomerase antibody (ab233508) at 2 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : Pig brain tissue lysate

    Secondary
    All lanes : HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 47 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Mannose Phosphate Isomerase using ab233508 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for Mannose Phosphate Isomerase using ab233508 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Formalin-fixed, paraffin-embedded human brain tissue stained for Mannose Phosphate Isomerase using ab233508 at 30 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Anti-Mannose Phosphate Isomerase antibody (ab233508) at 2 µg/ml + Recombinant human Mannose Phosphate Isomerase protein

    Predicted band size: 47 kDa

References

ab233508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up