Overview

  • Product name

    Anti-Mannosidase II/MAN2A1 antibody
    See all Mannosidase II/MAN2A1 primary antibodies
  • Description

    Rabbit polyclonal to Mannosidase II/MAN2A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Mannosidase II/MAN2A1 aa 31-181.
    Sequence:

    LDYPRNPRREGSFPQGQLSMLQEKIDHLERLLAENNEIISNIRDSVINLS ESVEDGPKSSQSNFSQGAGSHLLPSQLSLSVDTADCLFASQSGSHNSDVQ MLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGW L


    Database link: Q16706

  • Positive control

    • WB: HEK-293 and HepG2 cell lysate. ICC/IF: HeLa cells. IHC-P: Human lung cancer and cervical cancer tissue.
  • General notes

     This product was previously labelled as Mannosidase II

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000.

Target

  • Function

    Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 38 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3-1 antibody
    • 6-alpha-mannosidase antibody
    • Alpha mannosidase 2 antibody
    • alpha Mannosidase II antibody
    • Alpha-mannosidase 2 antibody
    • AMAN II antibody
    • Golgi alpha mannosidase II antibody
    • Golgi alpha-mannosidase II antibody
    • Golgi integral membrane protein 7 antibody
    • GOLIM7 antibody
    • MA2A1_HUMAN antibody
    • MAN II antibody
    • Man2a1 antibody
    • MANA 2 antibody
    • MANA2 antibody
    • MANII antibody
    • Mann II antibody
    • Mannosidase alpha class 2A member 1 antibody
    • Mannosidase Two antibody
    • Mannosidase, alpha type II antibody
    • Mannosidase, alpha, II antibody
    • Mannosyl oligosaccharide 1 3 1 6 alpha mannosidase antibody
    • Mannosyl oligosaccharide 1,3 1,6 alpha mannosidase antibody
    • Mannosyl-oligosaccharide 1 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Mannosidase II/MAN2A1 (green) using ab224611 (1/100 dilution) in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin embedded human cervical cancer tissue stained for Mannosidase II/MAN2A1 with ab224611 (1/100 dilution) in immunohistochemical analysis.

  • All lanes : Anti-Mannosidase II/MAN2A1 antibody (ab224611) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin embedded human lung cancer tissue stained for Mannosidase II/MAN2A1 with ab224611 (1/100 dilution) in immunohistochemical analysis.

References

ab224611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up