Overview

  • Product name

  • Description

    Rabbit polyclonal to MAP1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAP1B aa 1304-1451.
    Sequence:

    EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVI EKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPL IGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST


    Database link: P46821

  • Positive control

    • IHC-P: Human cerebral cortex tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100.

Target

  • Function

    Facilitates tyrosination of alpha-tubulin in neuronal microtubules (By similarity). Phosphorylated MAP1B may play a role in the cytoskeletal changes that accompany neurite extension. Possibly MAP1B binds to at least two tubulin subunits in the polymer, and this bridging of subunits might be involved in nucleating microtubule polymerization and in stabilizing microtubules. Acts as a positive cofactor in DAPK1-mediated autophagic vesicle formation and membrane blebbing.
  • Sequence similarities

    Belongs to the MAP1 family.
  • Domain

    Has a highly basic region with many copies of the sequence KKEE and KKEI/V, repeated but not at fixed intervals, which is responsible for the binding of MAP1B to microtubules.
  • Post-translational
    modifications

    LC1 is generated from MAP1B by proteolytic processing.
    S-nitrosylation at Cys-2464 enhances interaction with microtubules, and may act as an effector modification for neuronal nitric oxide synthase control of growth-cone size, growth-cone collapse and axon retraction.
  • Cellular localization

    Cytoplasm, cytoskeleton. Cytoplasm. Cell junction, synapse. Cell projection, dendritic spine. Colocalizes with DAPK1 in the microtubules and cortical actin fibers.
  • Information by UniProt
  • Database links

  • Alternative names

    • FUTSCH antibody
    • LC1 antibody
    • MAP-1B antibody
    • MAP1 light chain LC1 antibody
    • Map1b antibody
    • MAP1B_HUMAN antibody
    • MAP5 antibody
    • Microtubule associated protein 1B antibody
    • Mtap1b antibody
    • Mtap5 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MAP1B (green) using ab224115 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human cerebral cortex stained for MAP1B using ab224115 at 1/500 dilution in immunohistochemical analysis.

References

ab224115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up