Overview

  • Product name

    Anti-MAP1LC3B2 antibody
  • Description

    Rabbit polyclonal to MAP1LC3B2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAP1LC3B2 aa 1-47.
    Sequence:

    MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVL


    Database link: A6NCE7

  • Positive control

    • ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/20 - 1/200.

Target

  • Function

    Probably involved in formation of autophagosomal vacuoles (autophagosomes).
  • Sequence similarities

    Belongs to the MAP1 LC3 family.
  • Post-translational
    modifications

    The precursor molecule is cleaved by APG4B/ATG4B to form LC3-I (By similarity). This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form LC3-II.
  • Cellular localization

    Cytoplasm > cytoskeleton. Endomembrane system. Cytoplasmic vesicle > autophagosome membrane. LC3-II binds to the autophagic membranes.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATG8G antibody
    • MAP1LC3B2 antibody
    • Microtubule associated protein 1 light chain 3 beta 2 antibody
    • Microtubule associated proteins 1A/1B light chain 3B like protein antibody
    • Microtubule-associated proteins 1A/1B light chain 3 beta 2 antibody
    • Microtubule-associated proteins 1A/1B light chain 3B-like antibody
    • MP3B2_HUMAN antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for MAP1LC3B2 (green) using ab222801 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab222801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up