Overview

  • Product name

    Anti-MAP3K1 antibody [2F6]
    See all MAP3K1 primary antibodies
  • Description

    Mouse monoclonal [2F6] to MAP3K1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MAP3K1 aa 1077-1176.
    Sequence:

    SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNT ELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK


    Database link: Q13233

  • Positive control

    • IHC-P: Human uterine carcinoma, thyroid carcinoma and cervical carcinoma tissues.
  • General notes

     This product was previously labelled as MEKK1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Primary incubation for 30 minutes at RT.

Target

  • Function

    Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
    Contains 1 RING-type zinc finger.
    Contains 1 SWIM-type zinc finger.
  • Post-translational
    modifications

    Autophosphorylated.
  • Information by UniProt
  • Database links

  • Alternative names

    • M3K1_HUMAN antibody
    • MAP3K1 antibody
    • MAPK/ERK kinase kinase 1 antibody
    • MAPKKK1 antibody
    • MEK kinase 1 antibody
    • MEKK 1 antibody
    • Mekk antibody
    • MEKK1 antibody
    • Mitogen activated protein kinase kinase kinase 1 antibody
    • Mitogen activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase antibody
    • Mitogen-activated protein kinase kinase kinase 1 antibody
    • SRXY6 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human uterine carcinoma tissue stained for MAP3K1 using ab233925 at 1 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human thyroid carcinoma tissue stained for MAP3K1 using ab233925 at 1 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cervical carcinoma tissue stained for MAP3K1 using ab233925 at 1 μg/ml in immunohistochemical analysis.

References

ab233925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up