Overview

  • Product name

  • Description

    Rabbit polyclonal to MAP3K12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MAP3K12 aa 660-802.
    Sequence:

    GAKGEPPPPVGPGEGVGLLGTGREGTSGRGGSRAGSQHLTPAALLYRAAV TRSQKRGISSEEEEGEVDSEVELTSSQRWPQSLNMRQSLSTFSSENPSDG EEGTASEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIPLDP


    Database link: Q12852

  • Positive control

    • IHC-P: Human gallbladder tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be an activator of the JNK/SAPK pathway. Phosphorylates beta-casein, histone 1 and myelin basic protein in vitro.
  • Tissue specificity

    Highly expressed in brain and kidney.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    Interacts with MBIP through the leucine-zipper motif.
  • Post-translational
    modifications

    Autophosphorylated on Ser/Thr. Phosphorylated in cytosol under basal conditions and dephosphorylated when membrane-associated.
  • Cellular localization

    Cytoplasm. Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dlk antibody
    • Dual leucine zipper bearing kinase antibody
    • Dual leucine zipper kinase DLK antibody
    • Leucine-zipper protein kinase antibody
    • M3K12_HUMAN antibody
    • Map3k12 antibody
    • MAPK-upstream kinase antibody
    • MEKK12 antibody
    • Mitogen-activated protein kinase kinase kinase 12 antibody
    • Mixed lineage kinase antibody
    • MUK antibody
    • Protein kinase MUK antibody
    • ZPK antibody
    • ZPKP1 antibody
    see all

Images

  • Paraffin-embedded human gallbladder tissue stained for MAP3K12 using ab223783 at 1/200 dilution in immunohistochemical analysis.

References

ab223783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up