Anti-MAP3K13 antibody (ab224628)
Key features and details
- Rabbit polyclonal to MAP3K13
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-MAP3K13 antibody
See all MAP3K13 primary antibodies -
Description
Rabbit polyclonal to MAP3K13 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human MAP3K13 aa 506-835.
Sequence:AVEKKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPHKSGMQTKRPDLLRSE GIPTTEVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHSDFAAI LKNQPAQENSPHPTYLHQAQSQYPSLHHHNSLQQQYQQPPPAMSQSHHPR LNMHGQDIATCANNLRYFGPAAALRSPLSNHAQRQLPGSSPDLISTAMAA DCWRSSEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSP DLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKT RPLQKSGDDSSEEEEGEVDSEVEFPRRQRP
Database link: O43283 -
Positive control
- WB: Rat liver and lung tissue lysates; Mouse liver and stomach tissue lysates. IHC-P: Human brain tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224628 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Predicted molecular weight: 14,85,108 kDa. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Activates the JUN N-terminal pathway through activation of the MAP kinase kinase MAP2K7. Acts synergistically with PRDX3 to regulate the activation of NF-kappa-B in the cytosol. This activation is kinase-dependent and involves activating the IKK complex, the IKBKB-containing complex that phosphorylates inhibitors of NF-kappa-B. -
Tissue specificity
Expressed in the adult brain, liver, placenta and pancreas, with expression strongest in the pancreas. -
Sequence similarities
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
Contains 1 protein kinase domain. -
Post-translational
modificationsAutophosphorylated on serine and threonine residues. -
Cellular localization
Cytoplasm. Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9175 Human
- Entrez Gene: 71751 Mouse
- Entrez Gene: 303823 Rat
- Omim: 604915 Human
- SwissProt: O43283 Human
- SwissProt: Q1HKZ5 Mouse
- Unigene: 634586 Human
- Unigene: 656069 Human
see all -
Alternative names
- EC 2.7.11.25 antibody
- Leucine zipper bearing kinase antibody
- Leucine zipper-bearing kinase antibody
see all
Images
-
All lanes : Anti-MAP3K13 antibody (ab224628) at 1/500 dilution
Lane 1 : Rat liver tissue lysate
Lane 2 : Rat lung tissue lysate
Lane 3 : Mouse liver tissue lysate
Lane 4 : Mouse stomach tissue lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 14,85,108 kDa
Observed band size: 109 kDa why is the actual band size different from the predicted? -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MAP3K13 antibody (ab224628)
Paraffin-embedded human brain tissue stained for MAP3K13 using ab224628 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab224628 has not yet been referenced specifically in any publications.