Overview

  • Product name

  • Description

    Rabbit polyclonal to MAP3K4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human MAP3K4 aa 75-125. The exact sequence is proprietary. (NP_005913.2).
    Sequence:

    TNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAPNQPP H


    Database link: Q9Y6R4

  • Positive control

    • 293T and Jurkat whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab186125 was affinity purified using an epitope specific to MAP3K4 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 182 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Component of a protein kinase signal transduction cascade. Activates the CSBP2, P38 and JNK MAPK pathways, but not the ERK pathway. Specifically phosphorylates and activates MAP2K4 and MAP2K6.
  • Tissue specificity

    Expressed at high levels in heart, placenta, skeletal muscle and pancreas, and at lower levels in other tissues.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cytoplasm > perinuclear region. Localized in perinuclear vesicular-like structures, probably Golgi-associated vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ473J16.1 (mitogen-activated protein kinase kinase kinase 4) antibody
    • FLJ42439 antibody
    • KIAA0213 antibody
    • M3K4_HUMAN antibody
    • MAP three kinase 1 antibody
    • MAP/ERK kinase kinase 4 antibody
    • MAP3K4 antibody
    • MAPK/ERK kinase kinase 4 antibody
    • MAPKKK4 antibody
    • MEK kinase 4 antibody
    • MEKK 4 antibody
    • MEKK4 antibody
    • Mitogen-activated protein kinase kinase kinase 4 antibody
    • MTK1 antibody
    • predicted protein of HQ0412 antibody
    • PRO0412 antibody
    • RP3-473J16.4 antibody
    • SSK2/SSK22 MAP kinase kinase kinase, yeast, homolog of antibody
    see all

Images

  • All lanes : Anti-MAP3K4 antibody (ab186125) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate
    Lane 2 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 182 kDa


    Exposure time: 3 minutes
  • Detection of MAP3K4 in immunoprecipitates of 293T whole cell lysate (0.5 or 1 mg for IP, 20% of IP loaded) using ab186125 at 6 µg/reaction for IP (Lane 1). For WB detection, ab186125 was used at 1µg/ml. Lane 2: Control IgG IP.

    Detection: Chemiluminescence with an exposure time of 3 minutes.

References

This product has been referenced in:

  • Zhou D  et al. Long non-coding RNA-OIS1 inhibits HPV-positive, but not HPV-negative cervical squamous cell carcinoma by upregulating MTK-1. Oncol Lett 17:2923-2930 (2019). Read more (PubMed: 30854069) »
  • Du J  et al. Downregulation of ERBB3 decreases the proliferation, migration and invasion of cervical cancer cells though the interaction with MTK-1. Oncol Lett 16:3453-3458 (2018). Read more (PubMed: 30127948) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up