Overview

  • Product name

  • Description

    Rabbit polyclonal to MAP3K8/COT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human MAP3K8/COT aa 140-190 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVEIQACFRHEN I


    Database link: P41279

  • Positive control

    • Human colon carcinoma tissue, Mouse lymphoma tissue, Rat brain lysate.
  • General notes

     This product was previously labelled as MAP3K8

     

Properties

Applications

Our Abpromise guarantee covers the use of ab217684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 52 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Required for TLR4 activation of the MEK/ERK pathway. Able to activate NF-kappa-B 1 by stimulating proteasome-mediated proteolysis of NF-kappa-B 1/p105. Plays a role in the cell cycle. The longer form has some transforming activity, although it is much weaker than the activated cot oncoprotein.
  • Tissue specificity

    Expressed in several normal tissues and human tumor-derived cell lines.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Developmental stage

    Isoform 1 is activated specifically during the S and G2/M phases of the cell cycle.
  • Post-translational
    modifications

    Autophosphorylated. Isoform 1 undergoes phosphorylation mainly on Ser residues, and isoform 2 on both Ser and Thr residues.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AURA2 antibody
    • c COT antibody
    • Cancer Osaka thyroid oncogene antibody
    • CCOT antibody
    • COT antibody
    • COT proto oncogene serine/threonine protein kinase antibody
    • EST antibody
    • ESTF antibody
    • Ewing sarcoma transformant antibody
    • FLJ10486 antibody
    • M3K8_HUMAN antibody
    • MAP3K 8 antibody
    • MAP3K8 antibody
    • MEKK8 antibody
    • Mitogen activated protein kinase kinase kinase 8 antibody
    • Mitogen-activated protein kinase kinase kinase 8 antibody
    • Proto oncogene cCot antibody
    • Proto-oncogene c-Cot antibody
    • Serine/threonine protein kinase cot antibody
    • Serine/threonine-protein kinase cot antibody
    • TPL 2 antibody
    • TPL-2 antibody
    • TPL2 antibody
    • Tumor progression locus 2 antibody
    see all

Images

  • All lanes : Anti-MAP3K8/COT antibody (ab217684) at 1/200 dilution

    Lane 1 : Rat brain lysate
    Lane 2 : Rat heart lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/3000 dilution

    Predicted band size: 52 kDa



    12% gel. Incubation with ab217684 done at 4°C. Conjugation to secondary antibody done for 90min at 37°C.

References

ab217684 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up