Overview

  • Product name

  • Description

    Rabbit polyclonal to MAP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAP4 aa 555-631.
    Sequence:

    EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISED SHLESLQDVGQSAAPTFMISPETVTGT


    Database link: P27816

  • Positive control

    • WB: U-251 MG sp cell lysate; Human liver and tonsil lysates. IHC-P: Human heart muscle, skeletal muscle, and kidney tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224543 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 121 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Non-neuronal microtubule-associated protein. Promotes microtubule assembly.
  • Sequence similarities

    Contains 4 Tau/MAP repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity). Phosphorylation on Ser-787 negatively regulates MAP4 activity to promote microtubule assembly. Isoform 3 is phosphorylated on Ser-337 and Ser-338.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp779A1753 antibody
    • MAP-4 antibody
    • MAP4 antibody
    • MAP4_HUMAN antibody
    • MGC8617 antibody
    • Microtubule associated protein 4 antibody
    • Microtubule-associated protein 4 antibody
    • OTTHUMP00000210723 antibody
    • OTTHUMP00000210725 antibody
    • OTTHUMP00000210727 antibody
    • OTTHUMP00000210730 antibody
    see all

Images

  • Paraffin-embedded human kidney stained for MAP4 using ab224543 at 1/1000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for MAP4 using ab224543 at 1/1000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human soft tissue tissue stained for MAP4 using ab224543 at 1/1000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for MAP4 using ab224543 at 1/1000 dilution in immunohistochemical analysis.

  • All lanes : Anti-MAP4 antibody (ab224543) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 121 kDa

  • Paraffin-embedded human heart muscle tissue stained for MAP4 using ab224543 at 1/1000 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for MAP4 (green) using ab224543 at 4 µg/ml in ICC/IF.

References

ab224543 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224543.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up