Overview

  • Product name

  • Description

    Rabbit polyclonal to MAP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human MAP4 aa 243-549. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    MGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDM QPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEV APAKDVTLLKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAP SKDMGPPKENKIVPAKDLVLLSEIEVAQANDIISSTEISSAEKVALSSET EVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAKDV APSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEV ALTEDQV


    Database link: P27816

  • Positive control

    • IHC-P: Human lung cancer and prostate cancer tissues. WB: Pig testis lysate; Rat prostate gland lysate; Recombinant human MAP4 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 121 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Non-neuronal microtubule-associated protein. Promotes microtubule assembly.
  • Sequence similarities

    Contains 4 Tau/MAP repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity). Phosphorylation on Ser-787 negatively regulates MAP4 activity to promote microtubule assembly. Isoform 3 is phosphorylated on Ser-337 and Ser-338.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp779A1753 antibody
    • MAP-4 antibody
    • MAP4 antibody
    • MAP4_HUMAN antibody
    • MGC8617 antibody
    • Microtubule associated protein 4 antibody
    • Microtubule-associated protein 4 antibody
    • OTTHUMP00000210723 antibody
    • OTTHUMP00000210725 antibody
    • OTTHUMP00000210727 antibody
    • OTTHUMP00000210730 antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for MAP4 using ab232947 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for MAP4 using ab232947 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-MAP4 antibody (ab232947) at 3 µg/ml + Recombinant human MAP4 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 121 kDa

  • All lanes : Anti-MAP4 antibody (ab232947) at 3 µg/ml

    Lane 1 : Pig testis lysate
    Lane 2 : Rat prostate gland lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 121 kDa

References

ab232947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up