Anti-MAP4K4/NIK antibody (ab243321)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MAP4K4/NIK antibody
See all MAP4K4/NIK primary antibodies -
Description
Rabbit polyclonal to MAP4K4/NIK -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MAP4K4/NIK aa 619-737.
Sequence:AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSE VLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPL QGSGQQNSQAGQRNSTSSI
Database link: O95819-3 -
Positive control
- WB: MAP4K4/NIK overexpressing HEK-293T lysate. IHC-P: Human liver tissue.
-
General notes
This product was previously labelled as MAP4K4
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab243321 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. Appears to act upstream of the JUN N-terminal pathway. -
Tissue specificity
Appears to be ubiquitous. Expressed in all tissue types examined. Isoform 5 appears to be more abundant in the brain. Isoform 4 is predominant in the liver, skeletal muscle and placenta. -
Sequence similarities
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Contains 1 CNH domain.
Contains 1 protein kinase domain. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 9448 Human
- Omim: 604666 Human
- SwissProt: O95819 Human
- Unigene: 431550 Human
-
Alternative names
- FLH21957 antibody
- FLJ10410 antibody
- FLJ20373 antibody
see all
Images
-
Western blot - Anti-MAP4K4/NIK antibody (ab243321)All lanes : Anti-MAP4K4/NIK antibody (ab243321) at 0.4 µg/ml
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : MAP4K4/NIK overexpressing HEK-293T lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MAP4K4/NIK antibody (ab243321)Formalin-fixed, paraffin-embedded human liver tissue stained for MAP4K4/NIK using ab243321 at 1/50 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab243321 has not yet been referenced specifically in any publications.
