Overview

  • Product name

  • Description

    Rabbit polyclonal to MAPK 12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MAPK 12 aa 226-285.
    Sequence:

    FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFAS ILTNASPLAV


    Database link: P53778

  • Positive control

    • Human heart muscle tissue; HeLa cells; RT-4 and U251 MG cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab204395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 42 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Plays a role in myoblast differentiation and also in the down-regulation of cyclin D1 in response to hypoxia in adrenal cells suggesting MAPK12 may inhibit cell proliferation while promoting differentiation.
  • Tissue specificity

    Highly expressed in skeletal muscle and heart.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications

    Dually phosphorylated on Thr-183 and Tyr-185, which activates the enzyme.
  • Cellular localization

    Cytoplasm. Mitochondrion. Mitochondrial when associated with SH3BP5.
  • Information by UniProt
  • Database links

  • Alternative names

    • ERK 6 antibody
    • ERK-6 antibody
    • ERK6 antibody
    • Extracellular signal-regulated kinase 6 antibody
    • MAP kinase 12 antibody
    • MAP kinase p38 gamma antibody
    • MAPK 12 antibody
    • Mapk12 antibody
    • Mitogen Activated Protein Kinase 12 antibody
    • Mitogen activated protein kinase p38 gamma antibody
    • Mitogen-activated protein kinase 12 antibody
    • Mitogen-activated protein kinase p38 gamma antibody
    • MK12_HUMAN antibody
    • P38 GAMMA antibody
    • P38GAMMA antibody
    • PRKM12 antibody
    • SAPK 3 antibody
    • SAPK-3 antibody
    • SAPK3 antibody
    • Stress Activated Protein Kinase 3 antibody
    • Stress-activated protein kinase 3 antibody
    see all

Images

  • All lanes : Anti-MAPK 12 antibody (ab204395) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U251 MG cell lysate

    Predicted band size: 42 kDa

  • Immunohistochemical analysis of paraffin-embedded Human heart tissue labeling MAPK 12 with ab204395 at 1/1000 dilution. 

  • Immunofluorescent analysis of permeabilized HeLa cells labeling MAPK 12 (green) with ab204395 at 4 µg/ml. 

References

ab204395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up