Overview

  • Product name

    Anti-MAPK 12 antibody [OTI10E1]
    See all MAPK 12 primary antibodies
  • Description

    Mouse monoclonal [OTI10E1] to MAPK 12
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MAPK 12 aa 1-334. Expressed in 293T cells.
    Sequence:

    MEERYEALKELGAGNFGVARLVRDKRSKELVAVKYIERGKKIDENVQREI INHRSLRHPNIIRFKEVCLTPTHLAIVMEYAAGGELFEQICTAGRFSEDE ARYFFQQLISGVSYCHSLEICHRDLKLENTLLDGSPTPRVKICDFGYSKS ALLHSKPKSTVGTPAYIAPEVLSRKEYDGKVADVWSCGVTLYVMLVGSYP FEDPGDPRNFRKTISRILGVQYSIPDYVRVSSDCRRLLSQIFVADPSKRI TIPEIKKHTWFLKNLPKEISEREKADYKDTDAAPPTQAVEEIMRIIQEAK VPGDMAAADPALLAELAELKSDDEEEAADEYDTY


    Database link: P0C5D6

  • Positive control

    • IHC-P: Human breast and pancreas tissues. WB: HEK-293T cell lysate transfected with pCMV6-ENTRY MAPK 12 cDNA. Flow: MAPK 12 transfected HEK-293T cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab117985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/100.
WB 1/500. Predicted molecular weight: 42 kDa.
IHC-P 1/50.

Target

  • Function

    Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Plays a role in myoblast differentiation and also in the down-regulation of cyclin D1 in response to hypoxia in adrenal cells suggesting MAPK12 may inhibit cell proliferation while promoting differentiation.
  • Tissue specificity

    Highly expressed in skeletal muscle and heart.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications

    Dually phosphorylated on Thr-183 and Tyr-185, which activates the enzyme.
  • Cellular localization

    Cytoplasm. Mitochondrion. Mitochondrial when associated with SH3BP5.
  • Information by UniProt
  • Database links

  • Alternative names

    • ERK 6 antibody
    • ERK-6 antibody
    • ERK6 antibody
    • Extracellular signal-regulated kinase 6 antibody
    • MAP kinase 12 antibody
    • MAP kinase p38 gamma antibody
    • MAPK 12 antibody
    • Mapk12 antibody
    • Mitogen Activated Protein Kinase 12 antibody
    • Mitogen activated protein kinase p38 gamma antibody
    • Mitogen-activated protein kinase 12 antibody
    • Mitogen-activated protein kinase p38 gamma antibody
    • MK12_HUMAN antibody
    • P38 GAMMA antibody
    • P38GAMMA antibody
    • PRKM12 antibody
    • SAPK 3 antibody
    • SAPK-3 antibody
    • SAPK3 antibody
    • Stress Activated Protein Kinase 3 antibody
    • Stress-activated protein kinase 3 antibody
    see all

Images

  • All lanes : Anti-MAPK 12 antibody [OTI10E1] (ab117985) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY MAPK 12 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 42 kDa

  • Paraffin-embedded human breast tissue stained for MAPK 12 using ab117985 at 1/50 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human pancreas tissue stained for MAPK 12 using ab117985 at 1/50 dilution in immunohistochemical analysis.

     

  • Flow cytometry analysis of HEK293T cells transfected with either MAPK 12 overexpress plasmid (red) or empty vector control plasmid (blue) immunostained by ab117985.

References

ab117985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up