Overview

  • Product name

  • Description

    Rabbit polyclonal to MAPK 13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human MAPK 13 aa 1-365.
    Sequence:

    MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEK VAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNF YDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRD LKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHY NQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKL NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFS PIARKDSRRRSGMKL


    Database link: O15264-1

  • Positive control

    • WB: HeLa and A549 whole cell lysates. IHC-P: Human prostate cancer and testis tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 42 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K.
  • Tissue specificity

    Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications

    Dually phosphorylated on Thr-180 and Tyr-182, which activates the enzyme.
  • Information by UniProt
  • Database links

  • Alternative names

    • MAP kinase 13 antibody
    • MAP kinase p38 delta antibody
    • MAPK 13 antibody
    • MAPK-13 antibody
    • Mapk13 antibody
    • MGC99536 antibody
    • Mitogen activated protein kinase 13 antibody
    • Mitogen-activated protein kinase 13 antibody
    • Mitogen-activated protein kinase p38 delta antibody
    • MK13_HUMAN antibody
    • OTTHUMP00000016282 antibody
    • OTTHUMP00000016283 antibody
    • p38 delta antibody
    • P38delta antibody
    • PRKM13 antibody
    • SAPK 4 antibody
    • SAPK4 antibody
    • Stress activated protein kinase 4 antibody
    • Stress-activated protein kinase 4 antibody
    see all

Images

  • All lanes : Anti-MAPK 13 antibody (ab236738) at 1/500 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : A549 (Human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 42 kDa

  • Paraffin-embedded human testis tissue stained for MAPK 13 using ab236738 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for MAPK 13 using ab236738 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for MAPK 13 (green) using ab236738 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (muscle cell line C2C12)
Permeabilization
Yes - triton x100
Specification
muscle cell line C2C12
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Paraformaldehyde

Dr. Ortal Cohen

Verified customer

Submitted Jun 18 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up