Overview

  • Product name

  • Description

    Rabbit polyclonal to MAPRE1/EB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Chicken, Guinea pig, Turkey, Chimpanzee, Quail, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human MAPRE1/EB1 aa 200-245.
    Sequence:

    VNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDI


    Database link: NP_036457.1

  • Positive control

    • Whole cell lysate from HeLa cells, 293T cells and NIH3T3 cells.
  • General notes

     This product was previously labelled as MAPRE1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab86598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Detects a band of approximately 36 kDa (predicted molecular weight: 30 kDa).
IP Use at 10 µg/mg of lysate.

Target

  • Function

    May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the MAPRE family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 EB1 C-terminal domain.
  • Domain

    Composed of two functionally independent domains. The N-terminal domain forms an hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Associated with the microtubule network at the growing distal tip of microtubules. Also enriched at the centrosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5530600P05Rik antibody
    • Adenomatous polyposis coli binding protein EB 1 antibody
    • Adenomatous polyposis coli binding protein EB1 antibody
    • AI462499 antibody
    • AI504412 antibody
    • APC binding protein EB 1 antibody
    • APC binding protein EB1 antibody
    • APC-binding protein EB1 antibody
    • AW260097 antibody
    • BIM1p antibody
    • D2Ertd459e antibody
    • EB 1 antibody
    • EB1 antibody
    • End binding protein 1 antibody
    • End-binding protein 1 antibody
    • fa01e12 antibody
    • fc23e11 antibody
    • fi33c06 antibody
    • MAPRE 1 antibody
    • MAPRE1 antibody
    • Mapre3 antibody
    • MARE1_HUMAN antibody
    • MGC117374 antibody
    • MGC129946 antibody
    • MGC52508 antibody
    • Microtubule associated protein RP/EB family member 1 antibody
    • Microtubule-associated protein RP/EB family member 1 antibody
    • wu:fa01e12 antibody
    • wu:fc23e11 antibody
    • wu:fi33c06 antibody
    • zgc:55428 antibody
    • zgc:77807 antibody
    • zgc:85755 antibody
    see all

Images

  • All lanes : Anti-MAPRE1/EB1 antibody (ab86598) at 0.04 µg/ml

    Lane 1 : Whole cell lysate from HeLa cells at 50 µg
    Lane 2 : Whole cell lysate from HeLa cells at 15 µg
    Lane 3 : Whole cell lysate from HeLa cells at 5 µg
    Lane 4 : Whole cell lysate from 293T cells at 50 µg
    Lane 5 : Whole cell lysate from NIH3T3 cells at 50 µg

    Predicted band size: 30 kDa
    Observed band size: 36 kDa
    why is the actual band size different from the predicted?


    Exposure time: 10 seconds
  • Immunoprecipitation/ Western Blot of ab86598
    Lane 1: ab86598 at 10µg/mg whole cell lysate.
    Lane 2: Control IgG.
    ab86598 at 1µg/ml for WB.
    Whole cell lysate from Hela cells at 1mg for IP, 20% of IP loaded.
    Chemiluminescence with an exposure time of 3 seconds.

References

ab86598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up