Overview

  • Product name

    Anti-MAR6 antibody
  • Description

    Rabbit polyclonal to MAR6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MAR6 aa 59-169.
    Sequence:

    SVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGD PGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQP DSPLRNNYQGF


    Database link: Q6ICC9

  • Positive control

    • IHC-P: Human stomach tissue. WB: RT4 cell lysate. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as LDOC1L

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab246877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 26 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Anti-MAR6 antibody (ab246877) at 0.4 µg/ml + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 26 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MAR6 (green) using ab246877 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human stomach tissue stained for MAR6 using ab246877 at 1/50 dilution in immunohistochemical analysis.

References

ab246877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up